KEGG   Rubrivivax gelatinosus: RGE_26760Help
Entry
RGE_26760         CDS       T01803                                 

Definition
(GenBank) putative fumarylacetoacetase
  KO
K01555  fumarylacetoacetase [EC:3.7.1.2]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00350  Tyrosine metabolism
rge00643  Styrene degradation
rge01100  Metabolic pathways
rge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RGE_26760
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    RGE_26760
Enzymes [BR:rge01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.2  fumarylacetoacetase
     RGE_26760
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_26760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase FAA_hydrolase_N HTH_20
Motif
Other DBs
NCBI-ProteinID: BAL96015
UniProt: I0HSM8
Position
complement(2826609..2827931)
Genome map
AA seq 440 aa AA seqDB search
MRPGVDETHDPALTSWVESANAEGTDFPLQNLPFAVFRRAGSSQAWRGGVAIGDQVLDLA
ALQAAGVADGRAAEALALAAGETLNPLMAAGRGHWQALRQTLSRLLRAGALERRRLEAAL
VPQAAAEFTLPAQIGDYTDFYTSIHHATNVGKLFRPDHPLLPNYKWVPIGYHGRASSIVV
SGTGIRRPCGQLMRPDAEYPELAPTRRMDFELELGLFVGPGNALGEPVPIGAAEDRIFGV
CLLDDWSARDLQAWEYQPLGPFLAKNFATTISPWVVTLEALAPFRVGAARRPAGDPRPLP
YLDSPAAAEVGAVDLQLSVELQTAAMRARGEAGATISRTSWRHAYWTMAQLVAHHSVNGC
NLRPGDLLGTGTLSGPTPGEAGALIELSVGGKRPVGLPGGEQRCFLEDGDAVVLRGWCEA
PGRRRIGLGECRGTVLPAAS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccggcgtcgacgagacccatgacccggcgctcacgagctgggtcgagtcggcc
aacgccgaaggcaccgacttcccgctgcagaacctgccgttcgccgtcttccgccgcgcc
ggcagcagccaggcctggcgcggcggcgtcgcgatcggtgaccaggtgctggacctggcc
gcgctgcaggccgccggtgtcgccgacgggcgcgccgccgaggcgctggcgctggccgcc
ggcgagacgctgaacccgctgatggccgccggccgcggccactggcaggcgctgcgccaa
acgctgtcgcgcctgctgcgtgccggtgcgctcgaacgccgccgcctcgaagccgcgctg
gtgccgcaggccgcggccgagttcacgctgccggcgcagatcggcgactacaccgacttc
tacacctcgatccaccacgcgaccaacgtcggcaagctcttccgccccgaccacccgctg
ctgcccaactacaagtgggtgccgatcggctatcacgggcgcgcctcgagcatcgtcgtc
tccggcaccggcatccgccggccctgcggccagctgatgcggcccgacgccgagtacccc
gagctggcgccgacgcgccggatggacttcgagctcgagctcggcctcttcgtcggcccc
ggcaatgcactgggcgagccggtgccgatcggcgccgccgaagaccggatcttcggcgtc
tgcctgctcgacgactggtcggcgcgcgacctgcaggcctgggagtaccagccgctgggc
ccgttcctggcgaagaacttcgcgacgacgatctcgccctgggtcgtgacgctggaagcg
ctggcgccgttccgtgtcggcgccgcgcgccggccggccggcgacccgcggccgctgcct
tacctggattcgcccgcggcggccgaggtcggcgccgtcgacctgcagctctcggtcgaa
ctgcagaccgcggcgatgcgcgcacgcggcgaagccggcgcgacgatcagccgcaccagc
tggcgccacgcctactggacgatggcccagctcgtcgcccaccacagcgtcaacggctgc
aatctgcgcccgggcgatctgctgggcacgggcacgctgtcggggccgacgccgggcgaa
gccggcgcgctgatcgagctgtcggtcggcggcaaacgcccggtgggactgcccggcggc
gagcagcgttgttttctcgaagacggcgacgccgtcgtgctgcgtggctggtgcgaagcg
cccggccggcgccgcatcggcctgggcgaatgccgcggcacggtgctgccggcggcgagc
tga

DBGET integrated database retrieval system