KEGG   Rubrivivax gelatinosus: RGE_26770Help
Entry
RGE_26770         CDS       T01803                                 

Definition
(GenBank) putative dioxygenase
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: BAL96016
UniProt: I0HSM9
Position
complement(2827928..2828473)
Genome map
AA seq 181 aa AA seqDB search
MLVRKIHHVAYRCRDARETVEWYERHLGMRFILAIAEDEVPSTKAPDPYMHVFLDAGGGN
VLAFFELPTQPAMDRDRNTPAWVQHLALQVDSVDTLLATKARLEAAGIEVVGPTDHTIFR
SIYFFDPNGHRLELAADCATPEMMSRLDAVKREMLDEWSRTKKAPKHAAWMHDGSLAKED
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctggtccgcaagatccaccacgtcgcctaccgctgccgcgacgcgcgcgaaaccgtc
gagtggtacgagcgccatctcggcatgcgcttcatcctcgcgatcgccgaggacgaggtg
ccgtcgaccaaggcgcccgacccctacatgcacgtcttcctcgacgccggcggcggcaac
gtgctcgccttcttcgagctgccgacccagccggcgatggaccgcgaccgcaacacgccg
gcctgggtgcagcatctggcgctgcaggtcgactcggtcgacacgctgctggcgaccaag
gcgcggctcgaagccgccggcatcgaggtcgtcggcccgaccgaccacacgatcttccgc
agcatctatttcttcgatcccaacggccaccggctggaactggccgccgactgtgcgacg
cccgagatgatgtcgcggctggacgccgtcaagcgcgagatgctcgacgaatggagccgc
acgaagaaggcgcccaaacacgccgcctggatgcacgacggcagcctcgcgaaggaggac
gcatga

DBGET integrated database retrieval system