KEGG   Rubrivivax gelatinosus: RGE_26790Help
Entry
RGE_26790         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1611 DUF1611_N
Motif
Other DBs
NCBI-ProteinID: BAL96018
UniProt: I0HSN1
Position
complement(2829607..2830629)
Genome map
AA seq 340 aa AA seqDB search
MDIAHPYLMFLGDVHDQLAAKTAHGIVDWRREWCLGQTRLPGCQADLGLPEMTIAEGVAA
GAKTLIVGVANAGGVLPAHWVATIVQAIEAGLDVASGLHVRLGQIPEIREAAAHNGVQLF
DVRHNDQTFATGKGTKRSGLRLLTVGTDCSSGKKYTALALERAMRARGLDADFRATGQTG
VFISGHGVAIDAVVADFISGAVEWLAPAAAPGHWDLIEGQGSLFHPSFAGVSLGLLHGAQ
PDAFVVCHEPTRRTMRGVTHALPTIAEVIELTVRCGRLTNPAIRPVGIAINTKALGEAEA
RALLAELAHEHGLPATDPVRYGVDVLVDRLLADFPESGRV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcgcatccgtacctgatgttcctcggcgacgtgcacgaccagctcgccgcc
aagaccgcccacggcatcgtcgactggcgtcgagagtggtgtctcggccagacccggttg
cccggctgccaggccgacctcggcctgcccgagatgacgatcgccgaaggcgtggccgcc
ggcgcgaagacgctgatcgtcggcgtcgccaacgccggcggagtgctgccggcgcactgg
gtggcgaccatcgtccaggccatcgaggccgggctcgacgtcgccagcgggctgcacgtg
cgcctgggccagatccccgagatccgcgaggccgcggcgcacaacggcgtgcagctcttc
gacgtgcgccacaacgaccagaccttcgccaccggcaagggcaccaagcgctccgggctg
cggctgctgaccgtcggcaccgactgctcgtcgggcaagaagtacaccgcgctggcgctg
gaacgtgcgatgcgcgcccgcggcctggacgccgacttccgcgccaccggccagaccggc
gtcttcatctccggccacggcgtggccatcgacgccgtcgtcgccgacttcatctccggc
gccgtcgaatggctggcgccggccgccgcacccggccactgggacctgatcgaaggccag
ggctcgctgttccacccctcgttcgccggcgtctcgctgggcctgctgcatggcgcccag
cccgacgccttcgtcgtctgccacgagccgacgcggcgcacgatgcgcggcgtgacgcac
gcgctgccgacgatcgccgaggtcatcgagctgaccgtgcgctgcggccggctgaccaac
ccggcgatccgcccggtcggcatcgcgatcaacaccaaggcgctgggcgaggccgaggcg
cgcgcactgctggccgagctggcgcacgaacacggcctgccggccaccgacccggtgcgc
tacggcgtcgacgtgctcgtcgaccgcctgctcgccgacttccccgagagcggccgtgtc
tga

DBGET integrated database retrieval system