KEGG   Rubrivivax gelatinosus: RGE_26840Help
Entry
RGE_26840         CDS       T01803                                 

Gene name
relA
Definition
(GenBank) GTP pyrophosphokinase RelA
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RGE_26840 (relA)
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     RGE_26840 (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 ACT
Motif
Other DBs
NCBI-ProteinID: BAL96023
UniProt: I0HSN6
Position
complement(2837036..2839273)
Genome map
AA seq 745 aa AA seqDB search
MRTAEPSEAAVDAAAIVELAARETGVAEDGAAALERARAFAEPLLAGHLLDTGEPALVHA
DGVAAILQAIGAAPSMRAAAYLVYAGDYLQHPEEMVAKAFGQSYASLVTHTRRLVQIQRA
TRAATVLEAQRQQQAEQVRKMLLAFSHDLRVVLLRLASRLQTLRWYAAERVPCPEVLAEE
TQQIFAPLANRLGIWQIKWELEDLAFRFLQPDEYKRIARLLDEKRVEREQRIEGARRRLR
ERLAEAGLRAEVYGRPKHLHSIWKKMRGKGLPIERVFDLSALRVIVDDVAGCYAALSRVH
ECYRAVDGEYDDYIARPKPNGYQSLHTVVLDDDGRALEVQIRTRAMHEHAEHGVAAHWMY
KEAGVRGYAGVSAAGDFNERLAEARKAVLRELLAWERDFATTQDATASAVFDDRIYVFTP
QVNVIDLPVGGTPVDFAYALHTDLGHRCRGARVDGAMVPLNTALVSGQTIEIVAAKEGGP
SMDWLNPELGYLKSPRAKAKVRAWFNAQAQGLTIARGRELVEKLLQREGKTAVKLESLAE
QLGFKTADALFEVVGKDEFSLRNIEQILRPAAPAPAEEDEGIALRRPRHEGSGKGKGGVL
VVGVDSLLTTLARCCRPAPPDTIGGFVTRAKGVAIHRRDCTNFRHMAQKDPGRVIEVEWG
RERDGVYPLDVIIEASDRQGLLRDISEVFAKEKMNVIGVHTQSVKDARGGTAWMTFTIEV
SDTARLAQVLKHLAGIGGVRHARRR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgccgaaccttccgaagcggccgtcgacgcggccgcgatcgtcgaactggcg
gcgcgtgaaaccggtgtcgccgaagacggcgccgccgcgctcgaacgcgcccgcgctttt
gccgagccgctgctggccggtcacctgctcgacaccggcgagcccgcgctggtgcacgcc
gacggtgtcgccgcgatcctgcaggccatcggcgcggcgccgtcgatgcgcgccgccgcc
tacctggtctacgccggcgactacctccagcaccccgaggagatggtcgccaaggccttc
ggccagtcctacgccagcctggtgacgcacacccggcgcctggtgcagatccagcgcgcc
acgcgggccgcgacggtgctggaggcgcagcgccagcagcaggccgagcaggtgcgcaag
atgctgctcgctttctcgcacgacctgcgtgtcgtgctgctgcgcctggcgtcgcggctg
cagacgctgcgctggtacgccgccgagcgtgtcccctgtccggaagtgctggccgaggag
acgcagcagatcttcgcgccgctggccaaccgcctgggcatctggcagatcaagtgggag
ctggaggacctggccttccgcttcctgcagcccgacgagtacaagcgcatcgcgcgcctg
ctcgacgagaagcgtgtcgagcgcgagcagcgcatcgaaggcgcgcgccgccgcctgcgc
gagcgcctggccgaggccggcctgcgcgccgaggtctacggccggccgaagcatctgcac
agcatctggaagaagatgcgcggcaaggggctgccgatcgagcgtgtcttcgacctgagc
gcgctgcgtgtcatcgtcgacgacgtcgccggctgctacgcggcgctgtcgcgtgtgcac
gagtgctaccgcgccgtcgacggcgagtacgacgactacatcgcgcggcccaagcccaac
ggctaccagtcgctgcacaccgtcgtgctcgacgacgacggccgggcgctggaagtgcag
atccgcacgcgcgcgatgcacgagcacgccgagcacggcgtcgccgcacactggatgtac
aaggaagccggcgtgcgcggctacgccggcgtcagcgccgcgggcgacttcaacgagcgc
ctggccgaggcgcgcaaggccgtgctgcgcgagctgctggcctgggaacgcgacttcgcg
acgacgcaggacgccaccgcctcggcggtgttcgacgaccgcatctacgtcttcacgccg
caggtcaacgtcatcgacctgccggtgggcggcacgccggtggacttcgcctacgcgctg
cacaccgacctgggccaccgctgccgcggcgcgcgggtcgacggcgccatggtgccgctg
aacacggcgctggtctcggggcagacgatcgagatcgtcgccgccaaggaaggcgggccg
tcgatggactggctcaaccccgagctgggctatctgaagagcccgcgtgccaaggccaag
gtgcgcgcctggttcaacgcccaggcgcaggggctgacgatcgcgcgcggccgcgagctg
gtcgagaagctgctgcagcgcgagggcaagaccgcggtcaagctcgagtcgctggccgag
cagctgggcttcaagacggcggacgcgctgttcgaggtcgtcggcaaggacgagttctcg
ctgcgcaacatcgagcagatcctgcgcccggccgcgccggcgccggccgaggaggacgaa
ggcatcgcgctgcgccggccgcgccacgaaggcagcggcaagggcaagggcggggtgctg
gtcgtcggcgtcgattcgctgctgacgacgctggcgcgctgctgccgcccggcgccgccc
gacacgatcggcggcttcgtcacgcgcgccaagggcgtggccatccaccgccgcgactgc
accaacttccgccacatggcgcagaaggacccggggcgcgtcatcgaggtcgagtggggt
cgcgagcgcgacggcgtctacccgctggacgtgatcatcgaggccagcgaccgccagggc
ctgctgcgcgacatctccgaggtcttcgccaaggagaagatgaacgtcatcggcgtgcac
acgcagagcgtcaaggacgcgcgcggcggcaccgcgtggatgacgtttaccatcgaggtg
tccgacaccgcgcgtctggcgcaggtgctcaagcacctggccggcatcggcggcgtgcgc
cacgcgcggcgccgctga

DBGET integrated database retrieval system