KEGG   Rubrivivax gelatinosus: RGE_26870Help
Entry
RGE_26870         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIMPL
Motif
Other DBs
NCBI-ProteinID: BAL96026
UniProt: I0HSN9
Position
complement(2841011..2841712)
Genome map
AA seq 233 aa AA seqDB search
MPFARKAFAAAAFGLAAAAQAQTLPPPQNVVSLSASATAEVPRDMLSVSFSTSREGPDAQ
TVQSQLKQALDAALAEARKVAKPGQIELHTGGFSLYPRYSSKGVANGWQGSAELVAEGRD
VAGIAQLTGRVQTMTIARVGYSLSREAREKAEAELSAEAIARFRAKADTISRQFGFGGWG
IREVSVSASEPPSGVFPMAMKARAAMADEALPVEAGKASVTVSVSGSVQMSAK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgcccgaaaggccttcgccgccgccgcgttcggcctcgccgccgccgcccag
gcgcagacgctgccgccgccgcagaacgtcgtcagcctgtcggccagtgccaccgccgag
gtgccgcgcgacatgctgtcggtgagcttctcgacctcgcgcgaaggccccgacgcgcag
accgtgcagtcccagctcaagcaggcgctggacgccgcgctggccgaggcgcgcaaggtc
gccaagccgggccagatcgagctgcacaccggcggcttctcgctgtacccgcgctactcc
agcaaaggcgtggccaacggctggcagggcagcgccgagctggtggccgagggccgcgac
gtcgccggcatcgcccagctgaccgggcgggtgcagacgatgaccatcgcacgcgtcggc
tactcgctgtcgcgcgaagcgcgcgagaaggccgaagccgagctgtcggccgaggcgatc
gcgcgctttcgcgccaaggcggacacgatcagccgccagttcggtttcggcggctggggc
attcgcgaggtctcggtgtcggccagcgagccgccgtcgggcgtgttcccgatggcgatg
aaggcgcgtgccgcgatggccgacgaggcgctgccggtcgaagccggcaaggccagcgtc
acggtcagcgtctcgggcagcgtgcagatgtcggccaagtag

DBGET integrated database retrieval system