KEGG   Rubrivivax gelatinosus: RGE_26930Help
Entry
RGE_26930         CDS       T01803                                 

Gene name
serB
Definition
(GenBank) phosphoserine phosphatase SerB
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00260  Glycine, serine and threonine metabolism
rge00680  Methane metabolism
rge01100  Metabolic pathways
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
rge01230  Biosynthesis of amino acids
Module
rge_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    RGE_26930 (serB)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_26930 (serB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rge01009]
    RGE_26930 (serB)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     RGE_26930 (serB)
Protein phosphatases and associated proteins [BR:rge01009]
 HAD phosphatases
  Other HAD phosphatases
   RGE_26930 (serB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD Hydrolase Hydrolase_3 Put_Phosphatase HAD_2 PAP_PilO
Motif
Other DBs
NCBI-ProteinID: BAL96032
UniProt: I0HSP5
Position
2848695..2849408
Genome map
AA seq 237 aa AA seqDB search
MDAIEHAPGLHIRGFQPPLRLSDFRLVAFDMDSTLINIECVDEIARAAGRYDEVAAITEA
AMRGEISDYKESLRRRMALLAGVPEAALHQVAEQRLQLNPGVEAFVAACQAAGLKTMLVS
GGFSFFSERVRQRLKLDFARANTLGIAHGKLTGTLLQRPWGDIVDGAEKRRVLLEVAELM
GIEPSQAIAVGDGANDLPMMGAAGLSIAYHPKPAVAAEAMIAITSGGLDRALEVLRA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcgaacacgcccccggcctgcacatccgcggcttccaaccgccgctgcgg
ctctccgacttccggctggtggcgttcgacatggactcgacgctgatcaacatcgagtgt
gtcgacgagatcgcacgcgccgccggccgctacgacgaggtcgcggcgatcaccgaggcg
gcgatgcgcggcgagatcagcgactacaaggagagcctgcgccggcgcatggcgctgctg
gccggcgtgcccgaggcggcgctgcaccaggtcgccgagcagcggctgcagctgaatccc
ggcgtcgaagccttcgtcgccgcctgccaggccgccgggctgaagacgatgctcgtctcc
ggcggcttcagcttcttcagcgaacgcgtgcgccagcgcctgaagctggacttcgcgcgc
gccaacacgctgggcatcgcccacggcaagctcaccggcacgctgctgcagcggccctgg
ggcgacatcgtcgacggcgccgagaagcgccgcgtgctactcgaggtggccgagctgatg
ggcatcgaaccctcgcaggccatcgccgtcggcgacggtgccaacgacctgccgatgatg
ggcgccgccggcctgtcgatcgcctaccacccgaaacccgccgtcgccgccgaggcgatg
atcgcgatcacctccggcggcctcgaccgcgcgctcgaggtgctgcgggcctga

DBGET integrated database retrieval system