KEGG   Rubrivivax gelatinosus: RGE_26990Help
Entry
RGE_26990         CDS       T01803                                 

Gene name
argA
Definition
(GenBank) amino-acid acetyltransferase ArgA
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00220  Arginine biosynthesis
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01130  Biosynthesis of antibiotics
rge01210  2-Oxocarboxylic acid metabolism
rge01230  Biosynthesis of amino acids
Module
rge_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RGE_26990 (argA)
Enzymes [BR:rge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     RGE_26990 (argA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: BAL96038
UniProt: I0HSQ1
Position
2856297..2857637
Genome map
AA seq 446 aa AA seqDB search
MSVVFPHTFVPWFRAVAPYLHAYRGKTFVVAVTGEMIAAGKLNAFVQDLSILHAMGLKIV
LVHGFRPQVNEQLAAKGHVSRFSHGRRITDPVALDAAQEAAGQLRFEIEAAFSQGLPNTP
MANATVRVVSGNFLTARPVGIVDGVDFQSSGLVRRVDHGAIRRAIDIGALVLLSPFGFSP
TGEAFNLTMEDVATSTAIALQADKLVFMTEVPGIRENPDDPESAIDTELALADARRLLAA
WPAPAKPTDPAFYLQYCVKACEHGVERSHILPFAADGSLLLEVFTHDGIGTMVVDEKLES
LREATPDDVGGILQLIEPFERDGTLVRRERTEIERDVSAYTVIEHDGIIFGCAALYPYPE
ARTAEMAALTVSPLAQGQGDGERILKHIEHRAKAMGLESVFVLTTRTMHWFIKRGFAQVD
PDWLPEARKRKYNWDRRSQVLVKRLF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgtcttcccgcacaccttcgtcccctggttcagggcggtcgccccctacctg
catgcctaccggggcaagaccttcgtcgtcgcggtgaccggggagatgatcgccgccggc
aagctcaatgccttcgtgcaggacctgtcgatcctgcacgcgatggggctgaagatcgtg
ctggtgcacggcttccggccgcaggtcaacgagcagctcgccgccaagggccacgtctcg
cgcttcagccacggccgccgcatcaccgacccggtggcgctggacgctgcgcaggaagcc
gccggccagctgcgtttcgagatcgaggccgcgttctcgcaaggcctgccgaacacgccg
atggccaacgcgacggtgcgcgtggtctcgggcaacttcctgaccgcgcgcccggtcggc
atcgtcgacggcgtcgacttccagtccagcggcctggtgcggcgtgtggaccacggcgcg
atccggcgcgcgatcgacatcggcgcgctggtgctgctgtcgccgttcggtttctcgccg
accggcgaggccttcaacctgacgatggaggacgtcgcgacctccaccgcgatcgcgctg
caggccgacaagctggtcttcatgaccgaggtgccgggcatccgcgagaacccggacgac
ccggaaagcgcgatcgacaccgagctggcgctggccgacgcgcgccgcctgctcgccgcc
tggccggcgccggccaagcccaccgacccggccttctacctgcagtactgcgtgaaggcc
tgcgaacacggcgtcgagcgctcgcacatcctgcctttcgccgccgacggctcgctgctg
ctggaggtgttcacgcacgacggcatcggcacgatggtcgtcgacgagaagctggaaagc
ctgcgcgaggccacgcccgacgacgtcggcggcatcctgcagctgatcgaacccttcgaa
cgcgacggcaccctggtgcgccgcgagcgcaccgagatcgaacgcgacgtctcggcctac
acggtcatcgagcacgacggcatcatcttcggctgcgcggcgctctacccctaccccgag
gcgcgcaccgccgagatggcggcgctgaccgtctcgccgctggcccagggccagggcgac
ggcgagcgcatcctcaagcacatcgagcaccgcgccaaggcgatggggctggagagcgtg
ttcgtgctgaccacgcgcacgatgcactggttcatcaagcgcggcttcgcccaggtcgac
cccgactggctgcccgaggcgcgcaagcgcaagtacaactgggaccggcgctcgcaagtg
ctggtcaagcgactgttctga

DBGET integrated database retrieval system