KEGG   Rubrivivax gelatinosus: RGE_27000Help
Entry
RGE_27000         CDS       T01803                                 

Gene name
yggX
Definition
(GenBank) Fe(II) trafficking protein YggX
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iron_traffic DUF1281
Motif
Other DBs
NCBI-ProteinID: BAL96039
UniProt: I0HSQ2
Position
2857654..2857926
Genome map
AA seq 90 aa AA seqDB search
MARMVNCVYLKKEAEGLSFAPYPGELGKRIYDNVSKEAFEQWKRHQTMLVNENRLNLADA
RARQYLARQMEQFFFGGGADAPAGFVPPAA
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatggtgaactgcgtctacctgaagaaggaagccgaaggcctgtccttcgcg
ccctaccccggcgagctcggcaagcgcatctacgacaacgtctcgaaggaggccttcgag
cagtggaagcgccaccagacgatgctcgtcaacgagaaccgcctgaacctggccgacgcc
cgcgcccgccagtacctcgcccgccagatggagcagttcttcttcggcggcggcgccgac
gcgccggcgggcttcgttccgccggcggcctga

DBGET integrated database retrieval system