KEGG   Rubrivivax gelatinosus: RGE_27070Help
Entry
RGE_27070         CDS       T01803                                 

Definition
(GenBank) putative AMP or GMP cyclase containing FHA domain
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc FHA Yop-YscD_cpl FHA_2
Motif
Other DBs
NCBI-ProteinID: BAL96046
UniProt: I0HSQ9
Position
2867185..2868141
Genome map
AA seq 318 aa AA seqDB search
MTQISDLTVLFADLRGSTALYETLGNAEATSVVTHCVGSLTRPVADFGGHVVKTLGDGLM
AVFPRPSMALQSAALMHEVLDGIASRSQQRGASSGLKALKLQIAMARGEVVEMAGDCYGD
AVNVAARLLDHAGDNETLVTGEVLQGLTEQTRSRFRCLDRMVLRGRVEPVQVFVLGGRPG
TDMPATQFAGDAPPVSEPNGLRLEWVETDKVFASRQMPVVLGRGPQAEFRVDDSRVSRSH
ARVDWHGGAFQLTDLSYNGTYVRFADGEIVSLRRGSCTLHGSGEIGLGVSPGDPAATCVL
FDILRFDDTQPLLSADLL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatctccgacctcaccgtgctgttcgccgacttgcgcggcagcaccgcgctg
tacgagaccctcggcaatgccgaggcgacgtcggtggtcacgcattgcgtcggctcgctg
acgcgcccggtcgccgacttcggcggccacgtcgtcaagaccctgggcgacggcctgatg
gcggtgttcccgcggccgtcgatggcgctgcagtccgcggcgctgatgcacgaggtgctc
gacggcatcgccagccgcagccagcagcgcggcgcctcctcagggctcaaggccttgaag
ctgcagatcgcgatggcccgcggcgaggtcgtcgagatggccggcgactgctacggcgac
gccgtcaacgtcgccgcacgcctgctcgaccacgccggcgacaacgagaccctggtcacc
ggcgaggtgcttcagggcctcaccgagcagacgcgctcgcgattccgctgcctggaccgc
atggtgctgcgcggccgcgtcgagccggtgcaggtcttcgtgctcggcggccgccccggc
accgacatgccggcgacgcagttcgccggcgacgcgcccccggtgtccgagcccaacggg
ctgcgcctggagtgggtcgagaccgacaaggtcttcgccagccggcagatgccggtggtg
ctcgggcgcggcccgcaagccgagttccgcgtcgacgactcgcgcgtctcgcgttcgcac
gcccgcgtcgactggcacggcggcgccttccagctcaccgacctcagctacaacggcacc
tacgtgcgctttgccgacggcgagatcgtcagcctgcgccgcgggagctgcacgctgcac
ggcagcggcgagatcggcctgggcgtgtcgcccggcgatccggccgcgacctgcgtgctg
ttcgacatcctgcgtttcgacgacacccaaccgctgctctcggcggacctgctctag

DBGET integrated database retrieval system