KEGG   Rubrivivax gelatinosus: RGE_27080Help
Entry
RGE_27080         CDS       T01803                                 

Definition
(GenBank) response regulator receiver protein CheY-like
  KO
K02483  two-component system, OmpR family, response regulator
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rge02022]
    RGE_27080
Two-component system [BR:rge02022]
 OmpR family
  Unclassified
   RGE_27080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: BAL96047
UniProt: I0HSR0
Position
2868159..2868533
Genome map
AA seq 124 aa AA seqDB search
MRVLYVDDDRINTLLFEETCRCAGDFEVACASTGAEALEIAADFPAEALVIDLHLPDTNG
FELLPALRRALGDERLPAFLCTADEPSVVAAQAASAGFDGCWTKPVTVEAILAELQRSGR
GAAA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgtacgtcgacgacgaccggatcaacaccctgctcttcgaggagacctgc
cgctgcgcgggcgacttcgaagtggcctgcgcgagcaccggcgccgaagcgctggagatc
gccgccgactttcccgccgaggccctggtgatcgacctgcacctgcccgacaccaacggc
ttcgagctgctgcccgcgctgcgccgcgcgctcggcgacgagcgcctgcccgccttcctg
tgcaccgccgacgaacccagcgtggtggccgcgcaggccgcgtctgccggcttcgacggc
tgctggaccaagcccgtcaccgtcgaggccatcctggccgaactgcagcgcagcgggcgc
ggtgcggcggcatga

DBGET integrated database retrieval system