KEGG   Rubrivivax gelatinosus: RGE_27140Help
Entry
RGE_27140         CDS       T01803                                 

Definition
(GenBank) putative response regulator containing a TPR-domain
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg TPR_2 TPR_14 TPR_16 TPR_19 TPR_11 TPR_7 TPR_8 NARP1 ANAPC3 TPR_21 TPR_9 HrpB1_HrpK
Motif
Other DBs
NCBI-ProteinID: BAL96053
UniProt: I0HSR6
Position
2874124..2875803
Genome map
AA seq 559 aa AA seqDB search
MRLDRDIHLSKALVIDPNPTSRSILVAQLRDFGIGTVAQCGRVGDARSQLESRSFDIVLC
ENNFAGNDAAGQQLLDDLRRHQLLPLSTVFIMISSEATYNKVAEAAESALDSFLIKPHTA
AGLGDRILHARRRKKVLKDIFEAVDESRFDDAIQLCLKRFEDRGEFWLFAARVGAELLLN
HGRHREAWGLYEAVLKAQALPWARLGVARAQVEANEPGKAMSTLEALTADQPNFVDAYDV
MGRIHVDQGNLDEAAAVFLRAASLTPDSVTRLQKVGMLSFYLERWDDALKALERTVGIGI
SSKMFDPQTLVLLAFLRWRQSDSKGVQRCTENLEHLLSRSPDNQRLRRFAAVVHVLELAL
RLQHNDALQAVADLALEVREASFDVEAACNMLSLLARLAEAGYTMEQAGEWIDAIGLRHC
TAKSLTELLARAAGPQAEFAERIRNCQHRVLEVSEAAMAFSVAGDPGSAVRTLLDNGRAS
LNGKLIDTARLVLQRHHEKIDGADELQSTIDDLRQRYFALPTKLPIGDGPGRKAGGLALR
GAVASALGAEPEPPVAAAA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagactggaccgcgacatccacctcagcaaggcgctggtcatcgacccgaacccgacc
tcgcgcagcatcctcgtcgcccagctgcgcgacttcggcatcggcaccgtcgcccagtgc
ggccgcgtcggcgacgcccgcagccagctcgagtcgcgcagcttcgacatcgtgctgtgc
gagaacaacttcgccggcaacgacgccgccgggcagcagctgctcgacgatctgcggcgc
caccagctgctgccgctgtcgacggtgttcatcatgatcagcagcgaggcgacctacaac
aaggtcgccgaggccgccgagtcggcgctggacagcttcctgatcaagccgcacaccgcc
gccgggctgggcgaccgcatcctgcacgcccggcgccgcaagaaggtgctcaaggacatc
ttcgaggccgtcgacgagtcgcgcttcgacgacgcgatccagctgtgcctcaagcgcttc
gaggaccgcggcgagttctggctcttcgccgcgcgcgtcggcgccgagctgctgctcaac
cacggccgccaccgcgaagcctggggcctgtacgaggccgtgctcaaggcccaggccctg
ccctgggcgcgactgggcgtggcccgtgcgcaggtcgaggccaacgagccgggcaaggcg
atgtcgacgctggaggcgctgaccgccgaccagccgaacttcgtcgacgcctacgacgtg
atgggccgcatccacgtcgaccaaggcaacctcgacgaagccgcggccgtgttcttgcgc
gccgcgtcgctgacgccggactcggtgacgcggctgcagaaggtcggcatgctgtccttc
tacctggagcgctgggacgacgcgctgaaggcgctggaacgcacggtcggcatcggcatc
tcgtcgaagatgttcgatccgcagacgctggtgctgctggccttcctgcgctggcggcag
tccgactccaaaggcgtgcagcgctgcaccgagaacctggagcacctgctttcgcgcagc
cccgacaaccagcggttgcggcgcttcgccgccgtcgtgcacgtgctggaactggcgctg
cggctgcagcacaacgacgcgctgcaggccgtcgccgacctggcgctggaggtgcgcgaa
gcctcgttcgacgtcgaggcggcctgcaacatgctgtcgctgctggcgcgcctggccgag
gccggctacacgatggagcaggctggcgagtggatcgacgccatcggcctgcgccactgc
accgccaagtcgctgaccgaactgctggcgcgtgccgcgggcccgcaggccgagttcgcc
gaacgcatccgcaactgccagcaccgcgtgctcgaagtctccgaagcggcgatggccttc
agcgtcgccggcgacccgggttcggcggtgcgcacgctgctggacaacggccgcgcctcg
ctcaacggcaagctgatcgacaccgcgcgcctggtgctgcagcgccaccacgagaagatc
gacggcgccgacgaactccagtcgacgatcgacgatctgcgccagcgctacttcgcgctg
ccgaccaagctgccgatcggcgacggcccgggacgcaaggccggcggtctggcgctgcgc
ggcgcggtcgccagcgctctgggcgccgagcccgagccgccggtcgccgcggcggcctga

DBGET integrated database retrieval system