KEGG   Rubrivivax gelatinosus: RGE_27150Help
Entry
RGE_27150         CDS       T01803                                 

Definition
(GenBank) radical SAM domain-containing protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM DUF1848 DUF3040
Motif
Other DBs
NCBI-ProteinID: BAL96054
UniProt: I0HSR7
Position
complement(2875806..2876813)
Genome map
AA seq 335 aa AA seqDB search
MREAFDDGWGALDAVAGEAPQPLPTQVVEEHAGRILSENDSPDIGFEVSLNPYRGCEHGC
IYCYARPSHAYLGWSPGLDFETRLVAKVNAAERLRAALGAAGYRPRPIAIGTVTDAYQPI
ERWLGLTRAVLELLHETRHPFSLITKSALVERDLDLIAPMAAAGLACVDVTLTTLDPALA
RRLEPRAASPERRLRTIRTLAQAGVPVGVSVSPLIPFVNEPELERVLQAAHEAGAVRAFA
IVLRLPSELSPLFRHWLEQHFPERAARVMARVQEMRGGRDNDPRFGSRMRGEGVWAELLR
QRLRKTCDRLGLQRRHEALDVSAFRPPQGPQGSLF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaggctttcgacgatggctggggggcgctggacgccgtggccggcgaggcgccg
cagccgctgccgacccaggtcgtcgaggaacacgccggccgcatcctgagcgagaacgac
tcgccggacatcggcttcgaggtctcgctgaacccttaccgcggctgcgagcacggctgc
atctactgctatgcacggccatcgcacgcctatctcggctggtcgcccggcctggacttc
gagacccggctggtggccaaggtcaacgccgccgagcgcctgcgcgccgcgctgggcgcc
gccggctaccggccgcggccgatcgccatcggcaccgtcaccgacgcctaccagccgatc
gaacgctggctgggtctgacgcgtgcggtgctggaactgctgcacgagacgcggcacccg
ttctcgctgatcaccaagtcggcgctggtcgagcgcgacctggacctcatcgcaccgatg
gccgccgccgggctggcctgtgtcgacgtcacgctgacgacgctggacccggcgctggcg
cgccgtctggagccgcgcgcggcctcgccggaacgccggctgcgcacgatccgcacgctc
gcgcaagccggcgtgccggtgggcgtcagcgtctcgccgctgattcccttcgtcaacgaa
cccgagctcgaacgcgtgctgcaagccgcgcacgaagccggcgcggtgcgcgccttcgcg
atcgtgctgcgcctgccgtcggagctgtcgccgctgttccggcactggctggagcagcac
ttcccggagcgcgcggcgcgggtgatggcgcgtgtgcaggagatgcgcggcggccgcgac
aacgacccgcgtttcggcagccgcatgcgcggcgagggcgtctgggccgaactgctgcgc
cagcgattgcgcaagacctgcgatcgcctcggcttgcagcgccggcacgaggcgctggac
gtctcggcgttccgcccgccgcaaggcccgcagggcagcctgttctga

DBGET integrated database retrieval system