KEGG   Rubrivivax gelatinosus: RGE_27170Help
Entry
RGE_27170         CDS       T01803                                 

Gene name
rplI
Definition
(GenBank) 50S ribosomal protein L9 RplI
  KO
K02939  large subunit ribosomal protein L9
Organism
rge  Rubrivivax gelatinosus
Pathway
rge03010  Ribosome
Module
rge_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rge00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RGE_27170 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rge03011]
    RGE_27170 (rplI)
Ribosome [BR:rge03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    RGE_27170 (rplI)
  Bacteria
    RGE_27170 (rplI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N
Motif
Other DBs
NCBI-ProteinID: BAL96056
UniProt: I0HSR9
Position
complement(2878614..2879066)
Genome map
AA seq 150 aa AA seqDB search
MQVILLEKVAKLGNLGDIVKVKDGYARNFLIPTKLARRATDVAIKEFAERRAELEKAAAA
KLAAAQALGEQLAGSTVRIVQKAGVDGRLFGSVTNADIADALTQAGKAVQKSQVRMPNGP
LKTVGEHPVSVAPHGDVVVELTVQVVAQAD
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgatccttctcgaaaaggtcgccaagctcggcaacctcggcgacatcgtcaag
gtcaaggacggctacgcccgcaacttcctgatcccgaccaagctcgcgcgccgcgcgacc
gacgtcgcgatcaaggagttcgccgagcgccgtgccgaactggaaaaggccgcggccgcc
aagctcgctgccgcccaggccctgggcgagcaactcgccggcagcaccgtgcgcatcgtc
cagaaggccggtgtcgacggccgtctgttcggctcggtgaccaacgccgacatcgccgac
gcgctgacgcaagccggcaaggcggtgcagaaatcgcaggtgcgcatgcccaacggtccg
ctgaagaccgtcggcgagcacccggtgtcggtggccccgcacggcgacgtcgtcgtcgag
ctcaccgtccaggtggttgcgcaagccgactga

DBGET integrated database retrieval system