KEGG   Rubrivivax gelatinosus: RGE_27190Help
Entry
RGE_27190         CDS       T01803                                 

Gene name
priB
Definition
(GenBank) primosomal replication protein N PriB
  KO
K02686  primosomal replication protein N
Organism
rge  Rubrivivax gelatinosus
Pathway
rge03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RGE_27190 (priB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rge03400]
    RGE_27190 (priB)
DNA repair and recombination proteins [BR:rge03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RGE_27190 (priB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB
Motif
Other DBs
NCBI-ProteinID: BAL96058
UniProt: I0HSS1
Position
complement(2879414..2879707)
Genome map
AA seq 97 aa AA seqDB search
MNRLVLSAQLVERGALRYTPAGLPALDLSLKHESEVVENGGPRKVSLEIRALAIGADITA
VLAKLALGSDAEFGGFLAALRNGRGMRFHITSVAPKG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggctggttctctcggcgcaactggtggagcgaggcgcactgcggtacaccccc
gccggccttccggccctggacctgagcttgaagcacgagtccgaggtcgtcgagaacggc
ggtccgcgcaaggtctccctggagatccgggcgctggcgatcggggcggacatcaccgcg
gtgctggccaagctggcgctgggcagcgacgccgaattcggcggcttcctggcagccctg
cgcaacggacgcggcatgcggttccacatcacgtcggtcgcccccaaaggctga

DBGET integrated database retrieval system