KEGG   Rubrivivax gelatinosus: RGE_27230Help
Entry
RGE_27230         CDS       T01803                                 

Definition
(GenBank) putative phosphotransferase
  KO
K09773  [pyruvate, water dikinase]-phosphate phosphotransferase / [pyruvate, water dikinase] kinase [EC:2.7.4.28 2.7.11.33]
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RGE_27230
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.28  [pyruvate, water dikinase]-phosphate phosphotransferase
     RGE_27230
   2.7.11  Protein-serine/threonine kinases
    2.7.11.33  [pyruvate, water dikinase] kinase
     RGE_27230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinase-PPPase
Motif
Other DBs
NCBI-ProteinID: BAL96062
UniProt: I0HSS5
Position
2884944..2885768
Genome map
AA seq 274 aa AA seqDB search
MSERSVFFVSDGTGITAETFGNSILNQFPMKMRHVRRPFIDTLEKADAVVSEINEVAERE
GRRPVVFITLVEPKIRARVTGPGVNGMVLDMFRTFVEPLDDELGVKSNHRVGRFNDASQS
QEYNDRIEAINFSLAHDDGQSSRNLDLADVILVGVSRCGKTPTSLYLAMQHGVKAANYPL
IPEDFERGKLPSMLAPHRKKCFGLTIEPTRLAQIRNERRPGSRYAAIENCRYEVSEAETM
MRREGIQWLSSTHKSIEEIATTILRDIRPDRLVY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacgcagcgtcttcttcgtctccgacggcaccggcatcacggccgagactttc
ggcaactccatcctcaaccagttcccgatgaagatgcgccacgtgcgccggcccttcatc
gacacgctcgagaaggccgacgcggtcgtctccgagatcaacgaagtcgccgagcgcgaa
ggccgccggccggtggtcttcatcacgctcgtggagccgaagatccgcgcccgcgtcacc
ggcccgggcgtcaacggcatggtgctggacatgttccgcaccttcgtcgagccgctcgac
gacgagctgggcgtcaagtccaaccaccgcgtcggccgcttcaacgacgccagccagagc
caggagtacaacgaccgcatcgaggcgatcaacttcagcctcgcgcacgacgacggccag
agctcgcgcaacctcgatctggccgacgtgatcctggtcggcgtcagccgctgcggcaag
acgccgacctcgctgtacctggcgatgcagcacggcgtgaaggcggccaactacccgctg
atcccggaagacttcgaacgcggcaagctgccgtcgatgctggcgccgcaccgcaagaag
tgcttcggcctgacgatcgagccgacgcggctggcgcagatccgcaacgagcgccgcccg
ggcagccgctacgcggcgatcgagaactgccgctacgaggtcagcgaggccgagacgatg
atgcgccgcgaaggcatccagtggctgtcctcgacgcacaagtcgatcgaggagatcgcg
acgacgatcctgcgcgacatccgtccggaccggctggtctactga

DBGET integrated database retrieval system