KEGG   Rubrivivax gelatinosus: RGE_27250Help
Entry
RGE_27250         CDS       T01803                                 

Gene name
rnhB
Definition
(GenBank) ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge03030  DNA replication
Brite
KEGG Orthology (KO) [BR:rge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    RGE_27250 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rge03032]
    RGE_27250 (rnhB)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     RGE_27250 (rnhB)
DNA replication proteins [BR:rge03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     RGE_27250 (rnhB)
   Elongation factors (archaeal)
     RGE_27250 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-ProteinID: BAL96064
UniProt: I0HSS7
Position
complement(2886538..2887182)
Genome map
AA seq 214 aa AA seqDB search
MPSRKFSKAAPEQLDLGWHPPGLVAGVDEAGCGPLAGPVVAAAVILDDLAPIEGLADSKV
LSARQRERLFDEIQARALCVSIALASVEEIDTLNILHARLLAMKRAVETLRLLPKRVMVD
GNRLPVLRFPAEAVVGGDAKVPAISAASIVAKVHRDRLCAELHARWPDYGFDGHKGYPTR
EHLAALRRLGACPEHRRSFAPVRAVLEAAEKSTA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcgcaagttctcgaaagccgctcctgaacagctggacctgggctggcatccg
cccggcctggtggccggcgtggacgaagccggctgcgggccgctggccgggccggtggtc
gcagccgcggtgatcctcgacgacctggcgccgatcgagggcctggcggactccaaggtg
ctgagcgcgcgccagcgcgaacgcctgttcgatgagatccaggcgcgtgcgctgtgcgtc
tcgatcgcgctggccagcgtcgaggagatcgacacgctgaacatcctgcacgcccggctg
ctggcgatgaagcgtgcggtcgagacgctgcgcctgctgcccaagcgcgtgatggtcgat
ggcaaccgcctgccggtgctgcgtttcccggccgaggccgtggtcggcggcgacgccaag
gtgccggcgatctcggccgcgtccatcgtcgccaaggtgcaccgcgaccggctttgcgcc
gagctgcacgcacgctggcccgactacggcttcgacggccacaagggctacccgacgcgc
gagcatctggccgcgctgcgccgcctgggcgcctgccccgagcaccggcgcagcttcgcc
ccggtgcgggccgtgctcgaggcggccgagaagagcacggcatga

DBGET integrated database retrieval system