KEGG   Rubrivivax gelatinosus: RGE_27260Help
Entry
RGE_27260         CDS       T01803                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase LpxB
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00540  Lipopolysaccharide biosynthesis
rge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    RGE_27260 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rge01003]
    RGE_27260 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:rge01005]
    RGE_27260 (lpxB)
Enzymes [BR:rge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     RGE_27260 (lpxB)
Glycosyltransferases [BR:rge01003]
 Polysaccharide
  Bacterial polysaccharide
   RGE_27260 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:rge01005]
 Lipid A
  RGE_27260 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-ProteinID: BAL96065
UniProt: I0HSS8
Position
complement(2887148..2888284)
Genome map
AA seq 378 aa AA seqDB search
MRLAMVAGEASGDLLAGLLLGGLHERWPALAAAGIGGPKMAARGFEAWWPSDKLAVHGYA
DALRHYREIKGIRDRLGDRLLAEPPAVFVGVDAPDFNLGLEKRLKAAGIPSVHFVCPSIW
AWRGGRAKKMAASCDHVLCLFPFEPELLQRHGVAATYVGHPLADAIPIEPPRAAARAALG
LGEGDPVVAVLPGSRRGEIEHIAPAFLQAVERLHRQRPELRFLLPVAPGLRAMVEPLVAA
HAGDAPIQLLDGRSHEVLAACDVTLIASGTATLEAALFKRPMVIGYRMAWLSWQLMRRMG
YLPWVGLPNILARDFVVPELLQDRCEPEALARETLAWLDDAPRARALQARFLDLHHLLKR
DTARRATDALAQVLESRS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcgactggcgatggtcgcgggcgaagcatccggcgacctgctcgccggcctgctgctc
ggtggattgcacgaacgctggccggcgctggccgccgccggcatcggcggcccgaagatg
gccgcgcgcggtttcgaggcctggtggcccagcgacaagctggctgtgcacggctacgcc
gacgcgctgcgccactaccgcgagatcaagggcatccgcgaccgcctcggcgaccgcctg
ctggccgaaccgccggcggtcttcgtcggcgtcgacgcgcccgacttcaacctcggcctg
gagaagcggctgaaggccgccggcatcccgtcggtgcacttcgtctgcccgtcgatctgg
gcctggcgcggcgggcgcgcgaagaagatggccgccagctgcgaccatgtgctctgcctg
ttcccgttcgagcccgagctgctgcagcgccacggcgtcgccgcgacctacgtcggccac
ccgctggccgacgcgattccgatcgagccgccgcgcgccgccgcgcgtgcggcgctgggg
ttgggcgaaggcgatccggtcgtcgcggtgctgccgggcagccggcgcggcgagatcgag
cacatcgcaccggcctttctgcaggccgtcgagcgtctgcaccgccagcggccggaactg
cggttcctgctgccggtggcgccggggctgcgggcgatggtcgagccgctggtcgcggcg
cacgctggcgacgcgccgatccagttgctcgacggccgctcgcacgaggtgctggccgcc
tgcgacgtgacgctgatcgccagcggcacggcgacgctggaggcggcgctcttcaagcgc
ccgatggtcatcggctaccgcatggcctggctgtcgtggcagctgatgcgccgcatgggt
tatctgccctgggtcggcctgcccaacatcctggcgcgcgacttcgtcgtgcccgaactg
ctgcaggaccgctgcgaacccgaggccctggcccgcgagacgctggcctggctggacgac
gcgccgcgtgcgcgtgccttgcaggcgcgcttcctcgacctgcatcatctgctcaagcgc
gataccgcgcgccgtgccaccgatgccctcgcgcaagttctcgaaagccgctcctga

DBGET integrated database retrieval system