KEGG   Rubrivivax gelatinosus: RGE_27340Help
Entry
RGE_27340         CDS       T01803                                 

Gene name
cdsA
Definition
(GenBank) phosphatidate cytidylyltransferase CdsA
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00564  Glycerophospholipid metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
Module
rge_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RGE_27340 (cdsA)
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     RGE_27340 (cdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1
Motif
Other DBs
NCBI-ProteinID: BAL96073
UniProt: I0HST6
Position
complement(2895985..2896821)
Genome map
AA seq 278 aa AA seqDB search
MLRQRVITAVVLLLVLIASLAAPGPGWFALLTLVLLAAAGWEWARLNQAGQGVAIAMAAV
LAAACGASLAAGWVERAPSFVWWLAVALWVPGSVVALRGGPAAWPRLPQAARWILGLVML
WAAWLAIAHARVVGLNFMFSVFCLVWAADICAYFGGRAFGRRKLAPSVSPGKSWEGVWSG
VAGVLLLALAWIAVDRHWSLDGPGLYSRMLDTLGPALAAAALLALVAMSVVGDLVESLVK
RAAGAKDSSRLLPGHGGVLDRVDALLPVFPIALALAGV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgacagcgggtcatcacggccgtcgtcctgctcctcgtcctgatcgcgtcgctg
gcggcccccgggccggggtggttcgcgctgctgacgctggtgctgctggcggccgccggt
tgggaatgggcacggttgaaccaggccgggcagggcgtcgcgatcgcgatggccgccgtg
ctggcggccgcctgcggcgcgtcgctggcggccggctgggtggagcgggcaccgtccttc
gtctggtggctggccgtcgcgctgtgggtgccgggcagcgtcgtcgcgctgcgcggcggc
ccggcagcgtggccgaggctgccgcaggccgcgcgctggattctcggactggtgatgctc
tgggccgcctggctggcgatcgcccatgcccgcgtcgtcggcctgaatttcatgttctcg
gtcttctgcctcgtgtgggcggccgacatctgcgcctacttcggcggccgggccttcggc
cggcgcaagctcgcgccttcggtcagcccgggcaagagctgggaaggcgtctggagcggc
gtggccggggtgctgctgctggccctggcctggatcgccgtcgaccgccactggagcctg
gacggcccggggctgtacagccgcatgctcgatacgctggggccggcgctggcggccgcg
gcgctgctggcgctggtcgcgatgagcgtcgtcggcgacctcgtcgagtcgctggtcaag
cgcgcggccggcgccaaggacagcagccgcctgttgcccggccatggcggcgtgctcgac
cgtgtcgacgcgctgctgccggtcttcccgatcgccctggccttggccggggtctaa

DBGET integrated database retrieval system