KEGG   Rubrivivax gelatinosus: RGE_27360Help
Entry
RGE_27360         CDS       T01803                                 

Gene name
rrf
Definition
(GenBank) ribosome recycling factor Rrf
  KO
K02838  ribosome recycling factor
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rge03012]
    RGE_27360 (rrf)
Translation factors [BR:rge03012]
 Eukaryotic Type
  Release factors
   RGE_27360 (rrf)
 Prokaryotic Type
   RGE_27360 (rrf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRF TPP1
Motif
Other DBs
NCBI-ProteinID: BAL96075
UniProt: I0HST8
Position
complement(2897615..2898175)
Genome map
AA seq 186 aa AA seqDB search
MTTADIQKTAAEKMAKSVDSFKNELHKIRTGRAHPGILDQVHVEYYGSMLPISQVANVSL
LDARTISVQPWEKGMGAKIEKAIRESDLGLNPSAQGDLLRVPMPALTEERRKELTKVVRH
TGEEAKIHVRAVRRDANEQLKKLVKDKLVSEDDERRGQDEVQRLTDRTIAEIDKLVQAKE
AEVMAV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgctgacatccaaaagacggccgccgagaagatggcgaagtccgtcgattcg
ttcaagaacgaactgcacaagatccgcaccggccgcgcccacccgggcatcctggaccag
gtccacgtcgagtactacggctcgatgctgccgatcagccaggtcgccaacgtctcgctg
ctcgacgcccgcacgatcagcgtgcagccctgggaaaagggcatgggcgcgaagatcgag
aaggcgatccgcgagtcggatctcggcctgaacccctccgcccagggcgacctgctgcgc
gtgccgatgcccgcgctgaccgaagagcgccgcaaggagctgaccaaggtcgtgcgccac
accggcgaagaagccaagatccacgtgcgcgcggtgcgccgcgacgccaacgagcagctg
aagaagctggtcaaagacaaactcgtctccgaggacgacgagcgccgcgggcaggacgag
gtccagcgcctgacggatcgtacgatcgccgagatcgacaagctcgtccaagccaaggaa
gcggaggtcatggccgtctga

DBGET integrated database retrieval system