KEGG   Rubrivivax gelatinosus: RGE_27410Help
Entry
RGE_27410         CDS       T01803                                 

Gene name
dadA
Definition
(GenBank) putative D-amino acid dehydrogenase, small subunit DadA
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    RGE_27410 (dadA)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     RGE_27410 (dadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_2 Amino_oxidase UDPG_MGDP_dh_N ApbA 3HCDH_N Pyr_redox NAD_binding_9 FAD_binding_3 NAD_binding_2 F420_oxidored Glyco_transf_4 GIDA NAD_Gly3P_dh_N Thi4 TrkA_N Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAL96080
UniProt: I0HSU3
Position
2902311..2903564
Genome map
AA seq 417 aa AA seqDB search
MRVAVIGAGIVGVTTAFELAADGHEVVVYERRGSVAAETSFANAGVLAPGYVMPSAAPGM
PLKLMLQLFRREGALTLDGLGVWGQLPWLWRWWRACRPGVHATNRAAMLRLARLSQERLA
TLTRSLRLDYEHSRGYTVLLRSERELKRARPGLKLLAELGVPFELLDAERARQVEPGLNP
ETALRAAVHLPQDGVGNCRQFAQQLKTEAAQRGADFRFGVEVERIGAGGSPTVLACGREE
RFDAVVLCSGAASVPLLHSLRLKLPLAPVWGYAVTAPLRQLEAYPDLGPRSAIFDERFRV
TVSRLGQRVRVAGSSEIGGRADRYDERALRTLYRVLEDWFPGAFVATQAQRWKGARPSLP
DGPPVLGTSGLPGVWLNLGHGASGWALACGSARVLAEQVAGRAAPLDMTALGLERLR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcgccgtcatcggggccggcatcgtcggcgtcaccaccgcgttcgaactcgcc
gccgacgggcacgaggtcgtggtctacgaacgccgcggcagcgtcgccgcggaaaccagc
ttcgccaacgccggcgtgctggccccgggctacgtgatgccctcggccgcgccgggcatg
ccgctgaagctgatgctgcagctcttccgccgcgaaggcgcgctgacgctggacggcctg
ggcgtctggggccagctgccctggctgtggcgctggtggcgcgcctgccgccccggcgtg
cacgcgaccaaccgcgccgcgatgctgcgcctggcgcgactcagccaggagcgcctggcg
acgctgacgcgctcgctgcgcctggactacgagcacagccgcggctacacggtgctgctg
cgcagcgaacgcgaactcaagcgcgcccggccaggcctgaagctgctcgccgaactcggc
gtgcccttcgagttgctcgacgccgaacgtgcccgccaggtcgagccgggactgaacccc
gagacggcgctgcgcgcggccgtgcacctgccgcaggacggcgtcggcaactgccgccag
ttcgcgcagcagctgaagaccgaggccgcgcagcgcggcgccgacttccgcttcggtgtc
gaggtcgagcgcatcggcgccggcggcagcccgacggtgctcgcctgcggccgcgaggag
cgtttcgacgccgtcgtgctgtgcagcggcgcggcctcggtcccgctgctgcactcgctg
cggctgaagctgccgctggcgccggtctggggctacgcggtgaccgcaccgctgcgccag
ctcgaggcctatcccgacctcggcccgcgctcggcgatcttcgacgaacgcttccgcgtc
accgtcagccgcctcggccagcgcgtgcgtgtggccggcagcagcgagatcggcggccgc
gccgaccgctacgacgaacgcgcgctgcgcacgctgtaccgcgtgctcgaggactggttc
cccggcgccttcgtcgcgacccaggcgcagcgctggaagggcgcgcgccccagcctgccc
gatggcccaccggtgctgggcaccagcggcctgcccggtgtctggctgaacctgggccac
ggcgccagcggctgggcgctggcctgcggctcggcgcgtgtgctggccgaacaggtggcc
gggcgcgccgcgccgctggacatgacggcgctcggcctggaacgcctgcgctga

DBGET integrated database retrieval system