KEGG   Rubrivivax gelatinosus: RGE_27420Help
Entry
RGE_27420         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjeF_N Carb_kinase HK Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: BAL96081
UniProt: I0HSU4
Position
2903590..2905056
Genome map
AA seq 488 aa AA seqDB search
MSPALVAPKTGWPLHDAAASRAAEAVALAATPPHALMRRAGLGVARLALALAPHARSVAV
LAGPGNNGGDGLVAARHLHAAGKAVRVVLTGDVGRLPADAADALAAAQAAGVPIAEALDE
DPAELIIDALLGLGTRRAPEGRIATAIAWAASRGAPVLAVDLPSGLHPDTGQPLGEACIR
ADATLALLTLKPGLFTGEGRDHAGQVWFDELGVAAGGETARLAAAPARAVRRHAQHKGSF
GDVAVVGGAPGMAGAAWLAARAALAAGAGRVYCSLLDAEAPLLDPTRPELMGRPAWWRSP
PATLAAATVVAGCGGGQAVREAMPALLAHAGRLVLDADALNVLAADLSLQRLLTRRAQPT
VLTPHPLEAARLLGTTAAAVQADRLAAAQRLAERLGCVVVLKGSGSVVAAPGALPSLNPT
GNALLATAGTGDVLAGWLGGAWAAGGEAFATAVAAVWQHGHAADRALAAGAGRPLRAADL
VDALHASA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgccctcgtcgcccccaaaaccggctggccgctgcacgacgcggccgcctcc
cgcgccgccgaggcggtggcgctggccgccacgccgccgcacgcgctgatgcgccgcgcc
gggctcggtgtcgcccgcctggcgctggcgctggcaccgcacgcgcgcagcgtcgccgtg
ctcgccggcccgggcaacaacggcggcgacggcctcgtcgccgcacgccatctgcacgcc
gcgggcaaggccgtgcgcgtcgtgctgaccggcgacgtcggccggctgccggcggacgct
gccgacgcgctggcggcggcacaggccgccggcgtgccgatcgccgaagcgctggacgaa
gacccggccgagctgatcatcgacgccctgctcggcctgggcacgcgccgcgcgcccgaa
ggccgcatcgccaccgccatcgcctgggccgcgtcgcgcggcgcgccggtgctggcggtg
gacctgccctccggccttcatccggacaccggccagccgctgggcgaggcctgcattcgg
gccgacgcgacgctggcgctgctgacgctcaagcccgggctcttcaccggcgagggacgc
gaccacgccggccaggtctggttcgacgagctcggcgtcgcggccggcggcgagaccgcc
cgcctggccgccgcgccggcacgggccgtgcgccggcacgcccagcacaaaggcagtttc
ggcgacgtggccgtcgtcggcggcgcgcccggcatggccggcgccgcctggctggcggcg
cgcgcggcgctggccgccggcgccggccgcgtctactgcagcctgctcgacgccgaggcg
ccgctgctggacccgacccggcccgagctgatgggccgccccgcctggtggcgttcgccg
ccggcgacgctggccgcagcgaccgtcgtcgccggctgcggcggcggccaggcggtgcgc
gaggccatgccggctctgctggcgcatgccggccggctggtgctggacgccgacgcgctc
aacgtgctggccgccgacctctcgctgcagcggctgctgacgcgccgcgcgcaaccgacc
gtgctgacgccgcatccgctggaggccgcacgcctgctcggcacgacggccgccgcggtc
caggccgatcgcctggccgcggcgcagcgcctggccgagcgcctgggctgcgtcgtcgtg
ctgaaggggtcgggcagcgtcgtcgcggcaccgggcgccctgccctcgctgaacccgacc
ggcaacgcgctgctggccaccgccggcaccggcgacgtgctggccggctggctgggcggc
gcatgggcggccggtggcgaagccttcgccaccgcggtcgccgcggtctggcagcacggc
cacgccgccgaccgcgcgctggccgccggcgccggccggccgctgcgcgcagccgacctc
gtcgacgcgctgcacgcgagcgcctga

DBGET integrated database retrieval system