KEGG   Rubrivivax gelatinosus: RGE_27440Help
Entry
RGE_27440         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
  KO
K07101  uncharacterized protein
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RGE_27440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran
Motif
Other DBs
NCBI-ProteinID: BAL96083
UniProt: I0HSU6
Position
complement(2907548..2908069)
Genome map
AA seq 173 aa AA seqDB search
MLTDDGKHLYVSWDEYHLLIERLALKVHASGWEFDQILCLARGGMRPGDVMSRVFDKPLA
IMSTSSYRSDAGTIQGRLDMAKYITMPKGELAGRVLLVDDLADTGVTLRAVVDRLRGMPS
ISELRAAVLWVKGVSSYVPDYYCEMLDTSPWIHQPFEEYDNLRPDGLARKFAV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgacgacggcaagcacctctacgtttcctgggacgaataccacctgctgatc
gagcgcctggcgctcaaggtgcatgcctcgggttgggaattcgaccagatcctgtgcctg
gcgcgcggcggcatgcgtcccggcgacgtcatgtcgcgggttttcgacaagccgctggcg
atcatgtcgacgagttcctatcgctccgacgccggcaccatccagggccgcctggacatg
gccaagtacatcaccatgcccaagggtgaacttgccggccgcgtgctgctcgtcgacgac
ctggccgacaccggcgtgacgctgcgcgcggtggtcgaccgcctgcgtggcatgccgtcg
atctccgagctgcgcgccgcggtgctgtgggtgaagggcgtgtcgagctacgtgcccgac
tactactgcgagatgctcgacacgagcccgtggatccaccagcccttcgaggaatacgac
aaccttcgtcccgacggtctcgcccgcaagttcgcggtttga

DBGET integrated database retrieval system