KEGG   Rubrivivax gelatinosus: RGE_27460Help
Entry
RGE_27460         CDS       T01803                                 

Gene name
hisZ
Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit HisZ
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00340  Histidine metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    RGE_27460 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: BAL96085
UniProt: I0HSU8
Position
complement(2909463..2910626)
Genome map
AA seq 387 aa AA seqDB search
MLSAWLLPEHIADVLPADARRIEELRRRLLDRARGYGFELVMPPLLEHLESLLSGTGREL
DLKTFKLVDQLSGRTLGLRADTTPQAARIDAHLLNREGVTRLCYCGPVLHTRPSGLNATR
EPLQFGAEIFGHGGLEADLEVAELALDCLHAARLSDLTIDLADARVLRGVLAGAPVDASR
LQDVVAALSEKDASALEALAVGLPDETRHGLRALLRLYGGDEVLAAARSELPQRSLITAA
IEQLEWTARHLRAAFPGLAIGFDLSDMSGYAYYSGLRFAVYGAGSADALARGGRYDEVGA
VFGRNRPAVGFSLDLKALADLAPAVGAGRAIRAPWGDDAALRAAVRRLREAGETVIAALP
GHEVETQAFECDRELVLLDGQWQLRAC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagcttggctcttgcccgagcatatcgccgacgtcctgcccgccgacgcccga
cgcatcgaggagctgaggcggcgccttctggaccgcgcccgcggctacggcttcgagctc
gtgatgccgccgctgctcgagcacctcgagtcgctgctgtcgggcaccggtcgtgaactc
gacctcaagacgttcaagctcgtcgaccagctgagcggccgcacgctcggcctgcgcgcc
gacacgacgccgcaggcggcgcgcatcgacgcccatctgctcaaccgcgaaggtgtcacc
cggctctgctactgcggcccggtgctgcacacccggccctcggggctgaacgcgacgcgc
gagccgctgcagttcggcgccgagatcttcggtcacggtggcctggaagccgacctcgag
gtcgccgagctggcgctggactgcctgcacgctgcccgcctgtccgatctgacgatcgac
ttggccgacgcgcgcgtgctgcgcggcgtgctcgccggcgcgccggtggacgcctcgcgc
ctgcaggacgtcgtcgccgcgctgtccgagaaggacgcttcggcgctcgaagcgctggcc
gtcggcctgcccgacgagacccgccacggcctgcgggcgctgctgcgcctgtacggtggc
gacgaggtgttggccgcggcgcgcagcgagctgccccagcgcagcctgatcaccgccgcg
atcgagcagctcgaatggaccgcgcgccacctgcgcgccgcgttccccggtctggcgatc
ggcttcgacctgtcggacatgagcggctacgcctactacagcggcctgcgcttcgccgtc
tacggcgccggcagcgccgacgcgctggcgcggggcggccgctacgacgaagtcggcgcg
gtcttcggccgcaaccggccggccgtcggcttcagcctggacctgaaggcgctggccgac
ctggcgccggccgtcggcgccggccgcgcgatccgcgccccctggggcgacgacgccgcg
ctgcgcgccgccgtgcgccgtttgcgcgaagccggagaaaccgtcatcgccgcgctgccg
ggtcacgaagtcgagacccaggctttcgaatgcgaccgcgagctcgtgctgctggacggc
cagtggcagctgcgcgcctgctga

DBGET integrated database retrieval system