KEGG   Rubrivivax gelatinosus: RGE_30310
Entry
RGE_30310         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rge02044]
    RGE_30310
Secretion system [BR:rge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RGE_30310
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: BAL96370
UniProt: I0HTN3
Position
complement(3219899..3221218)
AA seq 439 aa
MIPSAKILWGEGLFLRPQHFQRQDAYHEARLAQAMRWLRPHAWGLAALELDEDALATGLL
RVLALQAVMPDGEIVCAPRDDELPEPVPLEASPAAAMTWELVLEPMRADAANYAAGEDRR
LAARYAAHTTEARDWFTGAPEADLVVLRRRPRLQPASGTVAGLPLLRLCRSPAGWALDRD
FVPPALVLAGAPALLALQRRMNERLRARLATLQGLRLGTAGLGADGRTADASALALAQAA
GSACARLARLGPDSAPERLFGALLELAGALTAFAAEPSQELPAYLHADAGPGFAMLEALL
RERLEAVASARWVDIVFDETRPSLRVARLDAAVPGPGGALYLSARAEMPLAALIEAVPAR
LKLGAPDDLDRLVHSAVAGVRLVHAAQWPAALPLAPGACCFLVEPQGPWYERLLQARALA
VHVPDGLPGLRLGLHALLG
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgatcccgtccgccaagatcctctggggcgaaggcctgttcctgcgcccgcagcacttc
cagcgccaggacgcttaccacgaggcgcggctggcgcaggccatgcgctggctgcggccg
cacgcctgggggttggccgcgctggagctcgacgaggacgcgctggcgaccggcctgttg
cgcgtgctggcgctgcaggcggtgatgcccgacggcgagatcgtctgcgcgccgcgcgac
gacgagctgcccgagccggtgccgctcgaagcgtcgccggccgcggccatgacctgggag
ctggtgctcgaaccgatgcgtgccgatgccgccaactacgccgccggcgaagaccgccgg
ctcgcggcgcgttacgccgcgcacaccaccgaggcgcgcgactggttcaccggcgcgccc
gaggccgatctggtcgtgctgcggcggcgtccgcgtttgcagccggccagtggcacggtt
gcgggcctgccgctcctgcgcttgtgccgcagcccggccggctgggccctggaccgcgac
ttcgtgccgcccgcgctggtgctcgccggcgctccggcgctgctggcgctgcagcggcgc
atgaacgaacgcctgcgcgcccggctggccacgctgcagggcctgcgcctgggcacggcg
ggcctgggcgccgacggtcgcactgccgatgcctcggccctggccctggcgcaggccgcc
ggcagtgcctgcgcccgcctcgctcgcctggggcctgacagcgcgcccgagcggctcttc
ggtgcgctgctcgagctggccggcgcgctgaccgccttcgccgccgagccgtcgcaggaa
ctgccggcctatctgcatgccgatgccggcccgggtttcgcgatgctggaggcgctgctg
cgcgagcggctggaggccgtggcctcggcgcgctgggtggacatcgttttcgacgagacg
cggccctcgctgcgcgtggcacgcctggacgctgccgtgcccgggccgggcggtgcgctg
tacctctcggcgcgggccgagatgccgctggccgcgctgatcgaggccgtgccggcgcgg
ctgaagctgggcgcgcccgacgacctcgatcgcctggtgcactcggccgtggccggcgtg
cgtctggtgcatgcggcgcagtggccggcggcgctgccgctggcgccgggcgcctgctgc
ttcctcgtcgagccacaggggccctggtacgagcgcctgctccaggcgcgtgcgctcgcg
gtgcacgtgcccgacgggctgccgggcctgcgcctgggcctgcacgccttgctgggctga

DBGET integrated database retrieval system