KEGG   Rubrivivax gelatinosus: RGE_30350
Entry
RGE_30350         CDS       T01803                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rge02044]
    RGE_30350
Secretion system [BR:rge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RGE_30350
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: BAL96374
UniProt: I0HTN7
Position
3223213..3224685
AA seq 490 aa
MDTAVLTPIAPPGRDLLDSIVLDSRVARGEAEHGRARELIVHLAHEVRAGTVAVSENLGL
ALDARIAELDELISAQLSEILHHPRFQRLEAAWTGLHYLCRHAAGGPQQRIAIFDATRQE
LVRDFSTAVDFDQSALFRKVYEEAFGTFGGAPFGALVGDYEIGRGAEDLYLVEQMSHVAA
AAHAPFLAAASPELLGLDSFADIGRPRDLAKVFDTAEYTRWKSLRASEDARYVGLVLPRF
LGRLPYDARHGNAVEGFCFTERVDGSEHGRYLWVNAAYALAARLNAAFASYGWCAAIRGV
EGGGLVEGLPAHAYRTDDGEHALKCPTEVAITDRREKELSDLGFIPLVHCRNTDYAAFFA
VQSVHKPRRYDSDAANANAALAAQLQYVFSVCRIAHYLKAMMREKVGSFASAANVEEFLN
RWIRQYVVEDDGATQETKAAYPLREASVQVSEIPGRAGAYRAVAFVRPHFQLDELSVSLR
LVADLAPRGA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggacaccgccgtcctgaccccgatcgcgccgcccgggcgcgacctgctcgacagcatc
gtgctcgacagccgcgtcgcgcgcggcgaggccgaacacggccgcgcccgcgaactcatc
gtgcacctcgcgcacgaggtgcgcgccggcacggtggccgtctccgagaacctcggcctg
gcgctggacgcgcgcatcgccgaactcgacgagctgatctccgcccagctcagcgagatc
ctccaccatccgcgcttccagcgcctggaagccgcgtggaccgggctgcactacctctgc
cgccatgccgccggcgggccgcagcagcgcatcgcgatcttcgacgccacgcgccaggag
ctggtgcgcgacttctccaccgccgtcgacttcgaccagtcggcgctgttccgcaaggtc
tacgaggaagccttcggaaccttcggcggcgcgcccttcggggcgctggtcggcgactac
gagatcggccgcggcgccgaggacctctacctcgtcgagcagatgtcgcacgtcgccgcc
gcggcgcacgcgcccttcctggccgcggcctcgcccgagttgctgggcctggacagcttc
gccgacatcggccgcccgcgcgacctggccaaggtcttcgacaccgccgagtacacgcgc
tggaagagcctgcgcgccagcgaggacgcgcgctacgtcggcctggtgctgccgcgtttc
ctcggccgcctgccctacgacgcgcgccacggcaacgccgtcgaaggcttctgcttcacc
gagcgggtcgacggctcggagcacgggcgctacctgtgggtcaacgcggcctacgcgctg
gcggcgcggctgaacgcggctttcgcctcctacggctggtgcgcggcgatccgcggcgtc
gaaggcggcggcctggtcgagggcctgccggcgcacgcctaccgcaccgacgacggcgaa
cacgcgctgaagtgcccgaccgaggtcgcgatcaccgaccggcgcgagaaggaactgtcc
gacctgggcttcatcccgctggtgcactgccgcaacaccgactacgccgcgttcttcgcg
gtgcagtcggtgcacaagccgcggcgctacgacagcgacgcggccaacgccaacgcggcg
ctggcggcacagctgcagtacgtcttcagcgtctgccgcatcgcgcactacctgaaggcc
atgatgcgcgagaaggtcggcagcttcgcctcggcggccaacgtcgaggagttcctcaac
cgctggatccgccagtacgtcgtcgaggacgacggcgcgacgcaggagaccaaggccgcc
tacccgctgcgcgaagccagcgtccaggtcagcgagatccccgggcgcgccggcgcctac
cgcgcggtggccttcgtgcggccgcacttccagctcgacgaactgagcgtctcgctgcgc
ctggtcgccgacctcgcgccccgcggcgcctga

DBGET integrated database retrieval system