KEGG   Rubrivivax gelatinosus: RGE_33720Help
Entry
RGE_33720         CDS       T01803                                 

Gene name
crtF
Definition
(GenBank) hydroxyneurosporene methyltransferase CrtF
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00906  Carotenoid biosynthesis
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    RGE_33720 (crtF)
Enzymes [BR:rge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     RGE_33720 (crtF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_24 Sigma70_r4 MTS Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: BAL96711
UniProt: I0HUM4
Position
complement(3599866..3601038)
Genome map
AA seq 390 aa AA seqDB search
MDRAETRPEAGPRRSPTLAERFRDWKHRTIARPGFQKWAAAFPLTRPVARKHARELFDLL
AGFVYSQILLACVRLGVFKMLADGPLPLATVAERCGLSLEAARRLVAAADSLELLDLQSG
DLVTLGRLGAPLVANEAITAMVEHHATLYSDLTDPVALLRGQGRPAMAGYWPYAAAAEAG
PGQPATLATEKVAEYSKLMTASQPLVAREVIAAYRFGRHKVLMDVGGGEGAFVRCVAAEV
PGVELRVFDLPAVAERANENFQRWGLAGRAQAFGGDFFADELPRGADVISLVRVAFDHPD
ERVLTLFKNVRRALPDNGTLVLAEAMAEVPGVEPIGDAYFGFYLLAMGRGRPRSAARLTQ
MLHEAGFASVRPLSTHMPLQAGVLVARCTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagccgagacgaggccggaggccgggccgcgccgttctccgacgctggccgag
cgctttcgcgactggaaacaccgcacgatcgcccgccccgggttccagaaatgggctgcg
gcctttccgctgacgcgtccggtggcgcgcaagcatgcgcgtgagctcttcgacctgctg
gccggcttcgtctattcgcagatcctgctggcctgcgtgcgtctgggcgtcttcaagatg
ctggccgacggcccgctgccgctggccaccgtcgccgaacgctgcggtttgagtctggaa
gccgcgcgccgtctggtggccgccgccgactcgctggaactgctggacctgcagagcggc
gacctcgtgacgctgggtcgcctgggtgcgccgctggtcgccaacgaggcgatcacggcg
atggtcgagcaccacgcgacgctgtacagcgacctcaccgacccggtggcgctgctgcgc
ggccagggccgcccggcgatggccggctactggccctacgccgcggctgccgaagccggc
cccggccagccggcgacgctggccaccgagaaggtcgccgagtactccaagctgatgacc
gcgtcgcagccgctggtggcgcgcgaggtcatcgccgcctaccgcttcggccgccacaag
gtgctgatggacgtcggcggcggcgagggcgctttcgtgcgctgcgtggccgccgaggtt
ccgggcgtcgagctgcgggtcttcgatctgccggcggtcgccgagcgtgccaacgagaac
ttccagcgctggggtctggccgggcgcgcccaggctttcggcggcgacttcttcgccgac
gagctgccgcgtggcgccgacgtcatctcccttgtccgcgtggccttcgaccaccctgat
gaacgggtgttgacgctgttcaagaacgtgcgtcgcgccttgcccgacaacggcaccctc
gtgctcgcggaagcgatggccgaggttccgggcgtcgagccgatcggtgacgcgtacttc
ggtttctacctgctcgcgatgggccgcggccggccgcgttcggcggctcgcctgacgcag
atgctgcacgaggccgggttcgcgagcgttcgcccgttgtccacgcacatgccgttgcag
gcgggtgtcctggtggctcgctgcactgcttaa

DBGET integrated database retrieval system