KEGG   Rubrivivax gelatinosus: RGE_35060Help
Entry
RGE_35060         CDS       T01803                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase Pcm
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rge  Rubrivivax gelatinosus
Brite
Enzymes [BR:rge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RGE_35060 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_11 PrmA MTS Methyltransf_31 Methyltransf_12 Methyltransf_18 Methyltransf_23 Methyltransf_32 GCD14 DUF938 IcmF-related tRNA_U5-meth_tr MetW
Motif
Other DBs
NCBI-ProteinID: BAL96845
UniProt: I0HV08
Position
3749210..3749884
Genome map
AA seq 224 aa AA seqDB search
MNTELARFNMIEQQIRPWEVLDENVLSLLATVKREDFVPPALKSLAFADLQVPLITDEPN
GPVMLEPKIQAKLLQDLQVQRHEKVLEIGTGSGFMAALLAHRAQQVWTLECRPALVAQAR
ENLRRASVTTARVVEVTPEEGARGLPAEAPFDAIVLSGSVAEVPRALLEQLKVGGRLAAI
VGELPIMQARIYTRVGPEAWSEVDLFETVAPRLQGFAERSRFAF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaactcgcccgcttcaacatgatcgagcagcagatccgtccgtgggaagtg
ctcgacgagaacgtgctgtcgctgctggcgacggtcaagcgcgaggatttcgtgccgccg
gcgctgaagtcgctggctttcgccgacctgcaggtgccgctgatcaccgacgagcccaac
ggcccggtgatgctggagcccaagatccaggccaagctgctgcaggatctgcaggtgcag
cgccacgagaaggtgctcgagatcggcaccggctcgggtttcatggccgctctgctggcg
caccgcgcgcagcaggtgtggacgctggaatgccgccccgcgctggtcgcccaggcgcgc
gagaacctgcgccgggccagcgtgacgacggcgcgcgtcgtcgaggtgacgcccgaggaa
ggcgcacgcggcctgcccgccgaagcgccgttcgacgccatcgtgctgtcgggctcggtc
gccgaggtgccgcgcgcgctgctcgaacaactcaaggtcggcggccgcctggcggcgatc
gtcggcgaactgccgatcatgcaggcgcgcatctacacccgcgtcggccccgaggcctgg
tccgaggtcgacctgttcgagaccgtcgcgccgcggctgcagggcttcgccgaacgctcg
cgtttcgcgttctga

DBGET integrated database retrieval system