KEGG   Rubrivivax gelatinosus: RGE_36060Help
Entry
RGE_36060         CDS       T01803                                 

Gene name
cbbL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit CbbL
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00630  Glyoxylate and dicarboxylate metabolism
rge00710  Carbon fixation in photosynthetic organisms
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
Module
rge_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rge_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rge_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RGE_36060 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RGE_36060 (cbbL)
Enzymes [BR:rge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RGE_36060 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAL96945
UniProt: I0HVA8
Position
complement(3846262..3847743)
Genome map
AA seq 493 aa AA seqDB search
MNKPHEPGATGDQILDKKQRYSAGVLKYRQMGYWDSDYVPKATDVVCLFRITPQEGVDPI
EAAAAVAGESSTATWTVVWTDRLTACDSYRAKAYKVEPVPGRPGEYFAWVAYDLILFEEG
SIANMTASLIGNVFSFKPLKAARLEDIQIPVAYVKTFKGPPTGLIVERERLDKFGRPLLG
ATTKPKLGLSGRNYGRVIYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMDGVNKASAA
TGEVKGSYLNVTGATMEDIYERAEFAKELGSVVIMVDLIIGWSAIQSIANWARKNDMIVH
MHRAGHGTYTRQKNHGVSFRVMAKWLRLAGVDHLHTGTAVGKLEGDPLTVQGYYNVCRDA
YTKQDLPRGLFFDQDWADLRKVMPVASGGIHAGQMHQLIDLFGDDVILQFGGGTIGHPAG
IQAGAVANRVALEAMVKARNEGRDIKNEGPEILQKAAQFCTPLKQALDTWKDVSFNYAST
DQSDYAVTPATSA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccgcatgaacccggcgccaccggcgaccagatcctggacaagaagcagcgc
tacagcgccggcgtcctgaagtaccgtcagatgggctactgggacagcgactacgtgccc
aaggccaccgacgtggtctgcctgttccgcatcacgccgcaggaaggcgtggacccgatc
gaagccgccgccgccgtggccggcgagtccagcaccgcgacctggaccgtggtctggacc
gaccgcctgaccgcctgcgacagctaccgcgccaaggcctacaaggtcgagccggtgccg
ggccggcccggcgagtacttcgcctgggtggcctacgacctgatcctgttcgaagaaggc
tcgatcgcgaacatgaccgcgagcctgatcggcaacgtcttcagcttcaagccgctgaag
gccgcgcggctggaggacatccagatcccggtggcctacgtcaagaccttcaagggcccg
ccgaccggcctgatcgtcgagcgcgagcgcctggacaagttcggccgcccgctgctgggt
gcgacgaccaagcccaagctgggcctgtcgggccgcaactacggccgcgtgatctacgaa
ggcctgaagggcggcctggacttcatgaaggacgacgagaacatcaactcgcagcccttc
atgcactggcgtgaccgcttcctctacgtgatggacggcgtcaacaaggccagcgccgcg
accggcgaggtcaagggctcgtacttgaacgtcaccggcgcgacgatggaagacatctac
gagcgtgccgagttcgccaaggaactgggcagcgtcgtgatcatggtcgacctgatcatc
ggctggagcgccatccagtcgatcgccaactgggcgcgcaagaacgacatgatcgttcac
atgcaccgcgccggccacggcacctacacgcgccagaagaaccacggcgtcagcttccgt
gtgatggccaagtggctgcgcctggcgggtgtcgaccacctgcacaccggcaccgcggtc
ggcaagctcgaaggcgacccgctgaccgtgcagggctactacaacgtctgccgcgacgcc
tacaccaagcaggacctgccgcgcggcctgttcttcgaccaggactgggccgacctgcgc
aaggtcatgccggtggcctcgggcggcatccacgccggccagatgcaccagctgatcgac
ctgttcggcgacgacgtgatcctgcagttcggcggcggcaccatcggccacccggcgggc
atccaggccggtgcggtcgccaaccgcgtcgcgctcgaagcgatggtcaaggcgcgcaac
gaaggccgcgacatcaagaacgaaggccccgagatcctgcagaaggcggctcagttctgc
actccgctaaagcaggcgctggacacctggaaggacgtgtcgttcaactacgccagcacc
gaccagtccgactacgccgtcaccccggccacctctgcctga

DBGET integrated database retrieval system