KEGG   Rubrivivax gelatinosus: RGE_40210Help
Entry
RGE_40210         CDS       T01803                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00790  Folate biosynthesis
rge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RGE_40210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rge04147]
    RGE_40210
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     RGE_40210
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_40210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: BAL97357
UniProt: I0HWH0
Position
4329738..4330127
Genome map
AA seq 129 aa AA seqDB search
MTTWRRKPANEPFAVDEVEARLKDELPAWHYEDGWIRRKYKTAGWKGTLMVVNTVGHLAE
AAWHHPDLTVSYAFVTVKLQTHDAKGITEKDFALAKKIDEVLMWQPGREADPVFEGTPDD
PRFKYLKYE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttggcgcaggaagccggcgaacgagccgttcgccgtcgacgaggtcgaagcc
cggctgaaggacgaactgccggcctggcattacgaagacggctggatccgccgcaagtac
aagaccgccggctggaagggcacgctgatggtcgtcaacaccgtcggccacctcgccgag
gccgcctggcaccaccccgacctgacggtgtcctacgccttcgtcacggtgaagctgcag
acgcacgacgccaagggcatcaccgagaaggacttcgcgctggcgaagaagatcgacgag
gtgctgatgtggcagcccggacgcgaggccgacccggtgttcgaaggcacgcccgacgac
ccgcgtttcaagtacctcaagtacgagtga

DBGET integrated database retrieval system