KEGG   Rubrivivax gelatinosus: RGE_41450Help
Entry
RGE_41450         CDS       T01803                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00051  Fructose and mannose metabolism
rge00520  Amino sugar and nucleotide sugar metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RGE_41450
   00520 Amino sugar and nucleotide sugar metabolism
    RGE_41450
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     RGE_41450
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     RGE_41450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: BAL97481
UniProt: I0HWU4
Position
complement(4448985..4450427)
Genome map
AA seq 480 aa AA seqDB search
MSIAVQPVVMAGGSGTRLWPLSRAGYPKQFLVLSGNTSLFQQAVARLQALGQGAVKAAAP
LVVGNEEHRFLVLDQLRELDIEPAAVLLEPTGRNTAPALTLAALQALEGGADPVLVVTPA
DQTLADEAAFAAAMASAIEVAAQGAVVILGITPDRPETGYGYVRTERSTGARVVAQFVEK
PDAETAARYLADGGYFWNAGMFVLKASVWMAALERWRPDIAAACRAAWAARSTDQRFVRP
GKAEFAAVPAESVDYAVMEKCPGSGQDIRMVELDAGWNDLGAWEAVWQVAAKDAQGNATV
GDAIVRDSRDTLVHATSRLVGAVGLDNIVVVETPDAVLVADRERSQEVKQIVAELGSQRR
GEHTLHRKVHRPWGWYDSIDSGPRHQVKRILVKPGASLSLQMHHHRAEHWIVVSGTAEVT
VGDKVILLAENQSTYIPLGEVHRLRNPGKLPLEIIEVQSGSYLGEDDIVRIEDTYGRIQP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgccgtccaaccggtcgtcatggccggaggctcgggcacgcggctgtggccg
ctgtcgcgcgccggttatccgaagcagttcctggtcctgtcgggcaacaccagcctgttc
cagcaggccgtcgcccggctgcaggcgctgggccagggcgccgtgaaggccgccgcgccg
ctggtcgtcggcaacgaggagcaccgcttcctcgtgctggaccagctgcgcgagctggac
atcgagccggccgccgtgctgctggagcccacgggccgcaacaccgcgccggcgctgacg
ctggcggcgctgcaggcgctcgaaggcggcgccgacccggtgctcgtcgtcacgccggcc
gaccagacgctggccgacgaggccgcgttcgccgccgcgatggccagcgcgatcgaggtc
gccgcgcaaggcgccgtcgtcatcctcggcatcacgcccgaccggcccgagaccggctac
ggctacgtgcgcaccgaacgcagcaccggcgcgcgggtcgtcgcccagttcgtcgagaag
cccgacgccgagaccgcggcgcgctacctcgccgacggcggctacttctggaacgccggc
atgttcgtgctcaaggccagcgtctggatggcggcgctggagcgctggcgcccggacatc
gccgcggcctgccgcgccgcctgggcggcacgcagcaccgaccagcgtttcgtgcgcccg
ggcaaggccgagttcgccgccgtgccggccgagtcggtggactacgcggtgatggagaag
tgccccggcagcggccaggacatccgcatggtcgagctcgacgccggctggaacgacctg
ggcgcctgggaagccgtctggcaggtcgcggccaaggacgcgcagggcaacgccacggtc
ggcgacgccatcgtgcgcgacagccgcgacacgctggtgcacgccaccagccggctggtc
ggcgccgtcgggctggacaacatcgtcgtcgtcgagacgcccgacgcggtgctggtggcc
gaccgcgagcgcagccaggaggtcaagcagatcgtcgccgagctgggcagccagcgccgc
ggcgagcacacgctgcaccgcaaggtgcaccgtccctggggctggtacgacagcatcgac
tcggggccgcgccaccaggtcaagcgcatcctggtcaagccgggcgcgagcctgagcctg
cagatgcaccaccaccgcgccgagcactggatcgtcgtcagcggcaccgccgaggtgacg
gtgggcgacaaggtcatcctgctggccgagaaccagagcacctacattccgctgggcgag
gtgcaccggctgcgcaaccccggcaagctgccgctggagatcatcgaggtgcagtcgggc
agctacctcggcgaagacgacatcgtgcgcatcgaagacacctacggacgcattcagcca
tga

DBGET integrated database retrieval system