KEGG   Rubrivivax gelatinosus: RGE_46570Help
Entry
RGE_46570         CDS       T01803                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase[ADP-forming] subunit bata SucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00020  Citrate cycle (TCA cycle)
rge00640  Propanoate metabolism
rge00660  C5-Branched dibasic acid metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
Module
rge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGE_46570 (sucC)
   00640 Propanoate metabolism
    RGE_46570 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RGE_46570 (sucC)
Enzymes [BR:rge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RGE_46570 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAL97990
UniProt: I0HYA3
Position
complement(4988650..4989810)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKELLRAHGVPVPRGYAAFTVQEALEAAQKLGGSVWVVKAQIHAGGRGKGGGV
KLARSIAEVETLASQILGMQLVTHQTGPEGQKVRRLLIEEGADIKKEYYVAALTDRATQK
VALMASSEGGMDIEEVAHATPEKILKVFVDPLVGLTEAQARELAVGIGVPEASQAQAIEV
FQKLYACYMASDASLAEINPLILEGHGGIKALDAKFNFDANALFRHPEIVAWRDLDEEDP
AEVEASKFDLSYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGASAEKVTE
AFKIMLKNPEVKGILVNIFGGIMKCDTIAEGVIAACKAVNLQVPLVVRMKGTNEDLGKKM
LADSGLPIISADTMAEAATAIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacgaataccaggccaaggaactgctgcgcgcgcacggggtacccgtgccg
cggggctatgcggcgttcacggtgcaggaggcgctggaggcggcgcagaagctcggcggc
tcggtgtgggtggtcaaggcccagatccacgccggcggccgcggcaagggcggtggcgtc
aagctcgcgcgttcgatcgccgaagtcgagacgctcgcttcgcagatcctcggcatgcag
ctcgtcacccaccagaccggccccgaaggccagaaggtgcgccggctgctgatcgaagaa
ggcgccgacatcaagaaggagtactacgtcgctgcgctcaccgaccgcgcgacgcagaag
gtggcgctgatggcgtcttccgaaggcggcatggacatcgaggaagtggcgcacgccacg
ccggagaagatcctcaaggtcttcgtcgacccgctggtcggcctgaccgaagcccaggcg
cgtgagctggcggtgggcatcggcgtgcccgaggccagccaggcgcaggccatcgaggtc
ttccagaagctctacgcctgctacatggccagcgacgccagcctcgccgagatcaacccg
ctgatcctcgaaggccacggcggcatcaaggcgctggacgcgaagttcaacttcgacgcc
aacgcgctgttccggcatccggagatcgtcgcctggcgcgacctggacgaagaagacccg
gccgaggtcgaggccagcaagttcgacctcagctacatcagcctggacggcaacatcggc
tgcctggtcaacggcgcggggctggcgatggcgacgatggacaccatcaagctcttcggc
ggcgagccggcgaacttcctcgacgtcggcggcggcgccagcgccgagaaggtcaccgag
gccttcaagatcatgctgaagaaccccgaggtgaagggcatcctcgtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccgaaggcgtcatcgccgcgtgcaaggcggtgaac
ctgcaggtgccgctggtggtgcgcatgaagggcaccaacgaggacctgggcaagaagatg
ctggccgacagcggcctgccgatcatcagcgccgacacgatggccgaagccgcgaccgca
atcgtcgcggcggtgaaataa

DBGET integrated database retrieval system