KEGG   Roseomonas gilardii: RGI145_07840Help
Entry
RGI145_07840      CDS       T04615                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00970  Aminoacyl-tRNA biosynthesis
rgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RGI145_07840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rgi03029]
    RGI145_07840
Enzymes [BR:rgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RGI145_07840
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RGI145_07840
Mitochondrial biogenesis [BR:rgi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RGI145_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: APT57015
UniProt: A0A1L7ADX3
Position
1:1750062..1750361
Genome map
AA seq 99 aa AA seqDB search
MSLDTATVRRVASLARIHLEDEEVTRLQAELNGILAWVEQLQAVDTAGIEPMAGGAAMPE
LAVLRMRDDVVTDGGMPEKVLANAPDRQGDFFTVPKVVE
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgataccgccaccgtccggcgcgtcgcgtcgctcgcccgcatccatctggag
gatgaggaggtcacgcgcctgcaagccgagctgaacggcatcctggcctgggtggaacaa
ctccaggccgtggacacggccggcatcgagcccatggcgggcggtgccgccatgccggaa
ctcgccgtcctgcgcatgcgggacgacgtggtgaccgacggcggcatgccggagaaggtc
ctcgccaacgcgcccgaccgccagggcgatttcttcaccgttccgaaggtcgtcgaataa

DBGET integrated database retrieval system