KEGG   Roseomonas gilardii: RGI145_13740Help
Entry
RGI145_13740      CDS       T04615                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rgi  Roseomonas gilardii
Pathway
rgi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RGI145_13740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rgi03011]
    RGI145_13740
Ribosome [BR:rgi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RGI145_13740
  Bacteria
    RGI145_13740
  Archaea
    RGI145_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 KORA
Motif
Other DBs
NCBI-ProteinID: APT58024
UniProt: A0A1L7AGW6
Position
1:complement(3015667..3016071)
Genome map
AA seq 134 aa AA seqDB search
MSKPKHERSLGETEAMATTRNIRVSPRKLNLAAGLIRGKKAQDAVAILTFSKFRITDTVK
KTLESAIANAENNHQLDVDRLVVSRAEVGRAVVMKRFHARGRGRSSRVEKWFSHITIVVA
EQQVADTAPQQEAA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgaagcatgagcggagcctcggtgagaccgaggccatggcgaccacccgg
aacatccgggtctcgccgcgcaagctgaatctggccgccggcctgatccgtggcaagaag
gcgcaggacgcggtggcgatcctgaccttctccaagttccggatcaccgacacggtcaag
aagacgctggagagcgcgatcgcgaacgcggagaacaaccaccagctggacgttgaccgt
ctggtggtgtcccgcgccgaggtcggccgcgctgttgtcatgaagcgcttccatgcgcgt
ggccgtggccggtcgtcgcgcgtcgagaagtggttcagccacatcaccatcgtggtggcg
gagcagcaggtggccgataccgcgccgcagcaggaggccgcgtaa

DBGET integrated database retrieval system