KEGG   Roseomonas gilardii: RGI145_19385Help
Entry
RGI145_19385      CDS       T04615                                 

Definition
(GenBank) epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00053  Ascorbate and aldarate metabolism
rgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    RGI145_19385
Enzymes [BR:rgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     RGI145_19385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_4 3Beta_HSD RmlD_sub_bind NAD_binding_10 adh_short
Motif
Other DBs
NCBI-ProteinID: APT58948
UniProt: A0A1L7AJJ7
Position
1:complement(4325396..4326235)
Genome map
AA seq 279 aa AA seqDB search
MSIPSKPVLLTGASGNLGRMLARELGAMGWTLRLTDLAPFPDPLPEKASFTRLDLSDGVA
LLKLAEGCGAILHFGGASTDLPFETVIGPNLRGVYHVYEAARREKARVIFASSNHSIGFH
ERPSGNEAKLDADCAFRPDSFYGLSKCYGELMGRLYWDKHGVENVNVRIGSSFDEPVDAR
MLSTWLSYGDLARMMERAVLAERTGHCVIWGASDNPATFWGQDHRDRIGWKPEDSAEPYR
DAVGGKKADPVTERYQGGGYTASGYSREEPSPRDPFALD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcattccgtccaagcccgtcctgctgacgggcgcgtccggcaatctgggccgcatg
ctggcgcgggaactgggggccatgggctggaccctgcggctgaccgacctggcgcccttc
cccgacccgctgccggagaaggcgagtttcacccgcctggacctgtccgacggcgtcgcg
ctgctgaagctggcggagggctgcggcgccatcctgcatttcggcggtgccagcaccgac
ctgcccttcgagacggtgatcgggccgaacctgcgcggcgtctatcacgtctatgaggcg
gcgcggcgggagaaggcgcgggtgatcttcgcctcctccaaccattccatcggcttccac
gagcgtccctccggcaacgaggcgaagctcgacgcggactgcgccttccggcccgacagc
ttctacgggttgagcaaatgctatggcgagctgatggggcggctgtactgggacaagcat
ggcgtcgagaacgtcaatgtccgcatcggctcctccttcgacgagccggtggatgcgcgg
atgctctccacctggctgtcctacggcgacctcgcgcggatgatggagcgcgccgtgctg
gccgagcgcacggggcattgcgtgatctggggcgcctccgacaaccccgccaccttctgg
gggcaggatcaccgcgaccgcatcggctggaagcccgaggacagcgccgagccgtaccgc
gacgcggtgggcggcaagaaggccgatccggtcaccgagcgctaccagggcggcggctac
accgcctcgggctacagccgcgaggagccgagcccgcgcgaccccttcgccctcgactga

DBGET integrated database retrieval system