KEGG   Roseomonas gilardii: RGI145_19985Help
Entry
RGI145_19985      CDS       T04615                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00071  Fatty acid degradation
rgi00072  Synthesis and degradation of ketone bodies
rgi00280  Valine, leucine and isoleucine degradation
rgi00310  Lysine degradation
rgi00362  Benzoate degradation
rgi00380  Tryptophan metabolism
rgi00620  Pyruvate metabolism
rgi00630  Glyoxylate and dicarboxylate metabolism
rgi00640  Propanoate metabolism
rgi00650  Butanoate metabolism
rgi00900  Terpenoid backbone biosynthesis
rgi01100  Metabolic pathways
rgi01110  Biosynthesis of secondary metabolites
rgi01120  Microbial metabolism in diverse environments
rgi01130  Biosynthesis of antibiotics
rgi01200  Carbon metabolism
rgi01212  Fatty acid metabolism
rgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGI145_19985
   00630 Glyoxylate and dicarboxylate metabolism
    RGI145_19985
   00640 Propanoate metabolism
    RGI145_19985
   00650 Butanoate metabolism
    RGI145_19985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RGI145_19985
   00072 Synthesis and degradation of ketone bodies
    RGI145_19985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGI145_19985
   00310 Lysine degradation
    RGI145_19985
   00380 Tryptophan metabolism
    RGI145_19985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RGI145_19985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGI145_19985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RGI145_19985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rgi04147]
    RGI145_19985
Enzymes [BR:rgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RGI145_19985
Exosome [BR:rgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGI145_19985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APT59620
UniProt: A0A1L7ALI3
Position
2:124089..125258
Genome map
AA seq 389 aa AA seqDB search
MTEACIVGWAHSPFGKLEEPDAESLIARVAGAAIADAGIAPSEVDAVFVGQFNNGFSRQD
FPASLPMQSVPELRFKPATRCENACASGSAAIYAARDFIAAGRGRLALVIGVEKMTATPG
PQVGDNLLGASYRREEGDIPGGFAGVFGRIAENYFQRFGDQTDALAAIAAKNHRNGVDNP
YAQMRRDLGFEFCRTASEKNPYVAGPLKRTDCSLVSDGAAALVLADEETACAMEHAVRFR
AAVQVNDYLPLSRRDPTRFEAGAQAWQRAFADAGLGLDDLSFVETHDCFTIAELIEYEAM
GLAPHGQGARVALDGITAPDGRLPVNRSGGLKSKGHPVGATGVSMHVMAAMQLTGRAGDM
QLPRADRGAVFNMGGAAVANYVSILERLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctgcatcgtcggctgggcgcattcccccttcggcaagctggaggaaccg
gatgccgagagcctgatcgcgcgcgtggcgggcgcggccatcgcggatgcgggcatcgcc
ccgtccgaggtggacgcggtcttcgtcgggcaattcaacaacggcttcagccggcaggat
ttcccggcctcgctgccgatgcagagcgtgcccgagttgcgcttcaagccggcgacgcgc
tgcgagaacgcctgtgcttccggttccgcggcgatctacgccgcccgcgacttcatcgcc
gccgggcgcggccgcctggccctggtgatcggggtggagaagatgactgccacgccgggg
ccccaggtgggcgacaatcttctcggtgcctcctatcgccgggaggaaggcgacatcccg
ggcggctttgccggcgtcttcggccgcatcgccgagaactacttccagcgcttcggcgac
cagacggatgcgctggccgcgatcgccgccaagaaccaccgcaacggcgtggacaatcct
tacgcgcagatgcgacgcgacctgggcttcgagttctgccgcacggcctcggagaagaac
ccctatgtcgccgggccgctgaagcgcaccgattgctcgctggtcagcgacggcgcggcg
gcgctggtgctggccgacgaggagaccgcctgtgccatggaacacgccgtccgcttccgc
gcggccgtacaggtgaacgactacctgcccctctcgcgccgcgatccgacgcgtttcgag
gccggcgcccaggcctggcagcgcgccttcgccgatgcggggctggggctggacgacctc
tccttcgtcgagacgcatgactgcttcaccatcgcggagctgatcgagtacgaggccatg
gggctggcgccgcatggccagggcgcgcgcgtggcgctggacggcatcaccgccccggac
ggcaggctgccggtgaaccgctccggcgggctgaagtccaaggggcatccggtgggcgcc
accggcgtctcgatgcatgtgatggcggcgatgcaactgacggggcgggcgggcgacatg
cagcttccccgcgccgaccggggcgctgtcttcaacatgggcggcgcggccgtcgccaac
tacgtctccatcctggagcgcctgtcttga

DBGET integrated database retrieval system