KEGG   Roseomonas gilardii: RGI145_20405Help
Entry
RGI145_20405      CDS       T04615                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00361  Chlorocyclohexane and chlorobenzene degradation
rgi00625  Chloroalkane and chloroalkene degradation
rgi01100  Metabolic pathways
rgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RGI145_20405
   00361 Chlorocyclohexane and chlorobenzene degradation
    RGI145_20405
Enzymes [BR:rgi01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     RGI145_20405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: APT59691
UniProt: A0A1L7ALQ0
Position
2:complement(223932..224666)
Genome map
AA seq 244 aa AA seqDB search
MRLTDFKVLTFDCYGTLIDWESGMIEGLRPLTAKVGRPLGRNEILEAHAFHESTQQIQTP
ARPYAELLAIVYKRLAEQWGVPVTLEECVAYGRSVGNWPAFEDSPGALQYLKKFYKLVIL
SNVDNASFAASNRRLQVTFDAIITAEDAGSYKPSPRNFEYMLQRLGAGLGGETIGREQIL
HTAESMFHDHKPANEFGLASCWIYRRHKDQGFGATMNPGTMPHVDFQFNSMADLVKAHQE
QLRG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttaccgacttcaaggttctcaccttcgactgctacggaaccctgatcgactgg
gaaagcggcatgatcgagggcctgcggccgctgaccgcgaaggtcggccgccccctcggc
cgcaacgagatcctggaggcgcatgccttccacgaatccacccagcagatccagacaccg
gcccgtccctatgccgagctgctcgcgatcgtctacaagcggctggcggagcaatggggc
gtgccggtcaccctggaggaatgcgtggcctacgggcggtccgtcggcaactggccggcc
ttcgaggattcgcccggcgcgctgcagtacctgaagaagttctacaagctggtgatcctg
tccaacgtggacaatgccagcttcgccgccagcaacaggcgcctgcaggtgaccttcgac
gcgatcatcaccgccgaggatgctggctcctacaagccgagcccgcggaacttcgagtac
atgctccagcgcctcggcgccgggctgggtggcgagacgatcggcagggagcagatcctg
catacggccgagagcatgttccacgaccataagccggcgaacgagttcggcctggcctcc
tgctggatctatcgccgccacaaggaccagggcttcggcgcgaccatgaaccccggcacg
atgccgcacgtggatttccagttcaacagcatggccgatctggtcaaggcgcatcaggaa
cagcttcgcggctga

DBGET integrated database retrieval system