KEGG   Roseomonas gilardii: RGI145_23290Help
Entry
RGI145_23290      CDS       T04615                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00625  Chloroalkane and chloroalkene degradation
rgi00680  Methane metabolism
rgi01100  Metabolic pathways
rgi01120  Microbial metabolism in diverse environments
rgi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    RGI145_23290
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RGI145_23290
Enzymes [BR:rgi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     RGI145_23290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C HI0933_like FAD_oxidored FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: APT60261
UniProt: A0A1L7ANB1
Position
p1:complement(180268..181407)
Genome map
AA seq 379 aa AA seqDB search
MKAVIYEGPRKVSVSRLPDARIEKPTDVVVRMTTTNICGSDLHMYEGRTSFETGRIFGHE
NLGQVVEAGSAVDRIKKGDWVCLPFNIGCGFCDNCERGLTGFCLTCNPGSAGAAYGFAEM
GPYQGGQAELLRVPYADFNCLSLPEDAEEKQDDYVMLSDILPTGYHATELAGVLPGETVA
VYGAGPVGLMAAYSALIKGASRVFVVDAHDDRLKLASELGAIPIDQRRCDPVEEILNHTN
GLGTDRGCECVGYQCCDKHGNEANYVTMNNLVASTKATGGIGVVGVFVPEDPNSNDPLAK
EGKMAFDFGAFWFKGQQIRTGQANVKHYNRRLMNLIHVGKAAPSKIISHRLSLDEAPDAY
KHFDARDTGWTKVVLKPAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcatctacgaaggaccgcgtaaggtcagcgtcagtaggttgccggatgcc
aggatcgagaagccgaccgacgtggtggtccgtatgaccaccaccaacatctgcggctct
gatctccacatgtacgagggccgcaccagcttcgagaccggccgcattttcggtcacgag
aaccttggacaggtggtcgaggccggctcggctgtagaccgcatcaagaagggtgactgg
gtctgcctgcccttcaacatcggctgcggcttctgcgacaattgcgagcggggcctgacc
ggcttctgcctcacctgcaatcctggcagcgccggtgcggcatacggctttgccgaaatg
ggtccgtaccagggtgggcaggccgaattgctgcgcgtgccctatgccgacttcaactgc
ctgtctctgcccgaggacgcggaggagaagcaggatgactacgtcatgctctccgatatt
ctgccgaccggctaccacgcgaccgaactcgccggcgtgcttcccggcgagactgtcgcg
gtctatggggccggtccggtcgggctgatggccgcctactccgcattgatcaagggcgcc
tcgcgagtgttcgtggtcgacgcacatgacgatcgcttgaagcttgccagcgagctgggc
gcgattccaatagaccaacgcaggtgtgatccggtcgaagaaatactcaaccacaccaac
ggtcttggcactgatcgcggctgcgagtgcgtcggctaccagtgctgtgacaagcacggc
aacgaagccaactacgtcactatgaacaacctagtggcctcgaccaaagcgactggtggg
atcggtgttgtcggcgtgttcgtgccggaggatccgaattccaacgatccgctggcgaag
gagggcaagatggcgttcgacttcggcgccttctggttcaagggccagcagatccgaacc
ggtcaagccaacgtgaagcactacaaccgtcgcttgatgaacctgatccatgtcggcaag
gctgcgccgtcgaagatcatctcgcaccgtctctcgcttgacgaagcgcccgacgcctac
aagcacttcgatgcgcgagacaccggttggaccaaggtcgtactaaagcctgcagcctag

DBGET integrated database retrieval system