KEGG   Rhodanobacter glycinis: CS053_11690Help
Entry
CS053_11690       CDS       T06136                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rgl  Rhodanobacter glycinis
Pathway
rgl00790  Folate biosynthesis
rgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CS053_11690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rgl04147]
    CS053_11690
Enzymes [BR:rgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CS053_11690
Exosome [BR:rgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CS053_11690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: QEE25086
UniProt: A0A5B9E4K9
Position
2664726..2665070
Genome map
AA seq 114 aa AA seqDB search
MNNQQPLATQHCQPRKGKEHALDQAAITTLLPQLPGWKVATDGKSLVKDFRFDDFHRTLG
FINAVGFMANHEDHHPDIEAGYGHCQLLWSTHDVGGLSLNDFVCAARVEALLER
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccagcagccgcttgccacccagcactgccagccgcgcaagggcaaggaacac
gcgctcgaccaggccgccatcaccaccttgctgccacagttgcccggatggaaggtcgcc
acggatggcaagtcgctggtgaaggatttccgtttcgacgacttccatcgcaccctgggt
ttcatcaacgcggtcggcttcatggccaaccacgaagaccatcacccggatatcgaagcc
ggctacggccactgccagctgctgtggtccacccacgacgtgggcgggctgtcgctgaac
gatttcgtctgtgcggcgcgcgtcgaggctctgctcgagcgctga

DBGET integrated database retrieval system