KEGG   Ruminococcus gnavus: RGna_16890
Entry
RGna_16890        CDS       T06719                                 

Definition
(GenBank) (2Fe-2S)-binding protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
rgn  Ruminococcus gnavus
Pathway
rgn00230  Purine metabolism
rgn01100  Metabolic pathways
rgn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rgn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RGna_16890
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: QHB24987
Position
3362380..3362877
AA seq 165 aa
MSEKQYKLVKCTINGEYRETMVDVRASLTDMLRNDYRLTSVKKGCEVGECGACNVIIDGE
CFNSCIYLAVWADGKNIRTLESLLGPNGELSDIQQAFIDETAVQCGFCTPGVIMSAVEIL
ESGKEYTREELRKLLSGHLCRCTGYENILNAVQKTMYKRLGKTEN
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagtgagaagcagtataaattggtaaaatgcaccatcaacggagaatacagggagacc
atggtggatgtccgcgcatcactgacggatatgctgagaaatgattatcggctgaccagt
gtaaaaaaaggctgtgaagtcggagaatgcggagcctgtaatgtgatcattgacggcgag
tgttttaactcctgtatttatctggcagtatgggcagacgggaaaaatatccggacactg
gagagccttctgggaccgaatggagagttgtcagatatccagcaggcgtttattgatgag
actgcggtacaatgcggattctgcacaccgggagtgatcatgagtgcagtggagatttta
gagtcaggcaaagaatatacaagagaagaattacggaaacttttatccggacacctgtgc
cgctgtaccggatatgaaaacattttgaatgcggtacaaaagaccatgtacaaacgactg
ggaaaaactgaaaattag

DBGET integrated database retrieval system