KEGG   Rhizobacter gummiphilus: A4W93_07700Help
Entry
A4W93_07700       CDS       T04831                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00250  Alanine, aspartate and glutamate metabolism
rgu00330  Arginine and proline metabolism
rgu01100  Metabolic pathways
rgu01110  Biosynthesis of secondary metabolites
rgu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4W93_07700
   00330 Arginine and proline metabolism
    A4W93_07700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rgu03000]
    A4W93_07700
Enzymes [BR:rgu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A4W93_07700
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     A4W93_07700
Transcription factors [BR:rgu03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    A4W93_07700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: ARN19806
UniProt: A0A1W6L6I0
Position
complement(1719778..1722798)
Genome map
AA seq 1006 aa AA seqDB search
MNQVPFSLSPRRAADRLPSPYRDEATVLQDLLSRLPASLSWPAAMDTARPWVAAVRESPA
PFWAMESLLRDYPISSAEGLALMRLAEALLRVPDAATAIALTADQLGKADFGTPAASHHK
VISGLSSSVIALSKRFLPDHDHEGGLFKRLGAQTVVAATVRAIQLMGRQFVLGRQIREAL
SEADGARKVQPQLRYSYDMLGEGARTEADARRYLASYHDAIEHIAKAGVRGAGPEGSDGI
SIKLSALFSRYEDAQRERVGDTLLPRVWSLMERAAAADINLTIDAEECDRLELSLDVFEA
LATRAAPRFPQWRGFGLAVQAYQTRARHVIDEVARIARTNGQRFMVRLVKGAYWDGEIKR
AQELGLPAYPVYTHKHHTDISYLACAGALIDHADVIYPQFATHNAGTIAAIQSMAKARGA
TYEMQRLHGMGEGVYREVLKDAGVPVRVYAPVGEHRDLLAYLVRRLLENGANSSFVHQLT
DESVPVDTLLASPLHPAAVPGLPLPVALYGFDGTSGRRNPQGADLAVTAERAVYEQAVDA
AVVESVPEAPVGGIAATMTRLHGGFTAWNATPLADRAAVLRRAADALEQRQPEFCGLLVR
EAHKTLGDCISEVREAIDFCRYYADQAEATLASRALPGPTGESNTLHLHGRGVFVCISPW
NFPLAIFAGQVVAALVAGNTVAAKPAEQTPAVAARFVALLHEAGVPADALVLQHGEGHTV
GAALVAHPLVAGVCFTGSTAVAKAINRALAAKDGPIVPLIAETGGINAMVVDSTALPEQV
VDAVVQSAFRSAGQRCSALRLLCVHEGIADGVIEMIAGALQELSVGDPSQLSTDVGPVID
AEAHANIAREVTRLEGSARVIGRAPVGLDVTGHVIAPVAFEVAKVSDLSAEIFGPVLHVV
RWSGDADAVIREVNQLGYGLTLGLQTRIDSRALRLAAEARIGNVYVNRNMIGAVVGVQPF
GGEGLSGTGPKAGGPHYLFRFCAEQTVTINTAAAGGNAALLAGTSH
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtccccttcagcctgtcgccccgccgtgcggccgaccggctcccgagcccg
taccgcgacgaggccaccgtgctgcaggacctgttgtcccgcctgcccgccagcctgtcg
tggccggcggcgatggacacggcccggccctgggtcgccgcggtgcgcgagtcgcccgcg
ccgttctgggcgatggagtcgctgctgcgcgactacccgatctcgagcgccgagggcctc
gcgctgatgcggctggccgaggcgctgctgcgcgtgcccgacgccgccaccgcgatcgcc
ctcacggccgaccagctcggcaaggccgacttcggcacgccggccgcaagccaccacaag
gtgatctcggggctgtcgtcgagtgtcatcgcgctgtccaagcgcttcctgcccgaccac
gaccatgaaggcggtctcttcaagcgcctgggcgcgcagaccgtcgtggcggccacggtg
cgcgcgatccagctgatgggccggcagttcgtgctgggccgccagatccgcgaggcattg
tccgaggccgacggcgcccgcaaggtccagccgcagctgcgctacagctacgacatgctc
ggcgaaggcgcgcgcaccgaggccgacgcgcgccgctacctcgcgtcgtaccacgacgcc
atcgagcacatcgcgaaggccggcgtgcgcggtgcggggccggagggttccgacggcatc
tcgatcaagctgagcgccctcttctcccgctacgaggacgcgcagcgcgagcgcgtcggc
gacacgctgctgccgcgcgtgtggtcgttgatggagcgcgccgctgcagccgacatcaac
ctgaccatcgacgccgaggagtgcgaccgcctcgaactgtcgctcgacgtgttcgaggcg
ctggccacccgcgccgcgccccgcttcccgcagtggcgcggcttcggtctcgccgtgcag
gcctaccagacccgcgcccgtcacgtgatcgacgaggtggcccgcatcgcccgcacgaac
ggccagcgcttcatggtgcgcctcgtcaagggcgcgtactgggacggcgagatcaagcgc
gcccaggagctgggccttccggcgtacccggtctacacgcacaagcaccacaccgacatc
tcgtacctcgcgtgcgccggcgccctgatcgaccacgccgatgtgatctacccgcagttc
gccacacacaacgccggcaccatcgcggccatccagtcgatggcgaaggcccgtggcgcg
acgtacgagatgcagcgcctgcacggcatgggcgaaggcgtgtaccgcgaagtgctgaag
gacgcgggcgtgccggtgcgcgtctacgcccccgtcggcgagcaccgcgacctgctggcc
tacctcgtgcgccgcctgctcgagaacggcgccaactcgtcgttcgtgcaccagctcacc
gacgagtccgtgcccgtcgacacgctgctcgcctcgccgctgcacccggccgccgtgccg
ggcctgccgctgccggtcgcgctgtacggcttcgacggcacctcgggccgccgcaacccg
caaggcgccgacctcgcggtgaccgccgaacgcgccgtctacgaacaggcggtggacgcg
gcggtggtcgaatccgtgcccgaggccccggtcggcggcatcgccgccacgatgacccgc
ctgcacggcggcttcaccgcctggaacgccacgccgctcgccgaccgcgccgccgtgctg
cgccgcgccgccgacgcgctggaacagcgccagcccgagttctgcggcctgctcgtgcgc
gaggcccacaagaccctcggcgactgcatctccgaggtgcgcgaggccatcgacttctgc
cgctactacgccgaccaggcggaggccacgctcgcgtcgcgcgccctcccgggaccgaca
ggcgagagcaacacgctgcacctgcacggccgcggcgtgttcgtctgcatcagcccgtgg
aacttcccgctcgcgatcttcgcgggccaggtcgtcgccgcgctggtggccggcaacacc
gtggcggccaagcccgccgagcagaccccggccgtcgccgcacgcttcgtcgcgctgctg
cacgaagccggcgtgcccgccgacgcgctcgtgctgcagcacggcgagggccacaccgtg
ggcgccgcgctcgtcgcgcacccgctcgtcgcgggcgtgtgtttcaccggctccacggcg
gtcgcgaaggccatcaaccgggcgctcgccgcgaaggacggccccatcgtgccgctgatc
gccgagaccggcggcatcaacgcgatggtggtcgacagcaccgcgctgcccgagcaggtg
gtggacgccgtggtgcagagcgccttccgcagcgccggccagcgctgctccgcgctgcgc
ctgctgtgcgtgcacgagggcatcgccgacggcgtgatcgagatgatcgccggggcgctg
caggagctgtccgtcggcgacccgtcgcagctgtcgaccgacgtcggcccggtgatcgac
gccgaggcccacgcgaacatcgcccgcgaggtgacccgcctcgaagggtcggcccgcgtg
atcggccgtgcccccgtgggcctggacgtcaccgggcacgtcatcgctccggtggcgttc
gaagtcgcgaaggtgtccgacctgtcggccgagatcttcggcccggtgctgcacgtggtg
cgctggtcgggtgatgccgacgccgtgatccgcgaggtgaaccagctcggctacggcctc
acgctcggcctgcagacccgcatcgactcgcgcgcgctgcgcctcgcggccgaggcccgc
atcggcaatgtctacgtcaaccgcaacatgatcggcgcggtggtcggtgtgcagccgttc
gggggcgagggcctgtccggcaccggcccgaaggccggcggcccgcactacctgttccgc
ttctgcgccgagcagaccgtgaccatcaacaccgcggcggccggcggcaacgcggcgctg
ctcgcggggacgtcgcactga

DBGET integrated database retrieval system