KEGG   Rhizobacter gummiphilus: A4W93_11025Help
Entry
A4W93_11025       CDS       T04831                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A4W93_11025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rgu02000]
    A4W93_11025
Enzymes [BR:rgu01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     A4W93_11025
Transporters [BR:rgu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    A4W93_11025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 AAA_25 RsgA_GTPase AAA_29 Zeta_toxin MMR_HSR1 AAA_23 SRP54
Motif
Other DBs
NCBI-ProteinID: ARN20388
UniProt: A0A1W6L8A3
Position
complement(2484516..2486039)
Genome map
AA seq 507 aa AA seqDB search
MTIATFPVLLELSGIDKQFFGVPVLKQAGLCLRAGEVHALMGQNGAGKSTLIKVLTGVYA
ADAGAMTLAGQPVRPASPEQAQALGISTVYQEVNLCPNLSVAENIFAGRYPRLGPLGAWR
IDWAGMNRRARDLLGRLNLDIDVTRTLSTFPVAVQQMVAIARALSVESRVLILDEPTSSL
DTGEVQQLFDVLRRLREEGLAILFVTHFLDQVYAISDRITVLRNGSLVGEYRVEDLGPKA
LIAAMVGRELADAATADPDQVPAADGEPVLEARGLGQRGQLKPLDLALRAGEVVGLGGLL
GSGRTELARLLFGLATPDSGELRMRGKAVKLDSPADAVAHGLALCPEDRKTDGIVAELSV
RENIVLALQARTGLKRCLSAAQERALADKYVKALGIKTADIDTPIGLLSGGNQQKALLAR
WLATGPSVLILDEPTRGIDVAAKQEIMDEILRLAQEGMAVLFISSEMAEVVRVSHRIAVL
RDRAKVGELPAGSGEHAVYHLIAEETP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgccaccttccccgtgctgctggaactctccggcatcgacaagcagttcttc
ggcgtgcccgtgctgaagcaggccggcctgtgcctgcgcgcgggcgaggtgcacgcgctc
atgggccagaacggcgccggcaagtccaccctcatcaaggtgctgacgggcgtgtacgcg
gccgacgcgggggcgatgaccctcgcgggccagccggtgcggccggcctcgccggagcag
gcccaggcgctcggcatcagcacggtgtaccaggaggtcaacctctgccccaacctgtcg
gtggccgagaacatcttcgcggggcgctacccccgcctcggcccgctgggcgcgtggcgc
atcgactgggccggcatgaaccggcgcgcccgtgacctgctcggccggttgaacctcgac
atcgacgtcacccgcacgctgtccacgttcccggtggccgtgcagcagatggtggccatc
gcccgcgcgctcagcgtcgagtcgcgcgtgctgatcctcgacgagcccacgtcgagcctc
gacaccggcgaggtgcagcagctgttcgacgtgctgcgccggctgcgcgaggagggcctc
gccatcctcttcgtcacccacttcctcgaccaggtctacgccatctccgaccgcatcacg
gtgctgcgcaatggcagcctcgtgggcgagtaccgcgtggaagacctgggaccgaaggcg
ttgatcgccgcgatggtgggccgggaactggcggacgccgccaccgccgaccccgaccag
gtgcccgcggccgacggcgagcccgtgctcgaggcccgcggcctcggccagcgcggccag
ctcaagccgctcgacctggcgctgcgcgcgggcgaggtggtgggcctgggcggcctgctc
ggctccggccgcaccgaactcgcccggctgctgttcggcctggccacgcccgactcgggc
gaactgcgcatgcgcggcaaggcggtcaagctcgactccccggccgacgccgtggcccac
ggcctcgcgctgtgtccggaagaccgaaagaccgacggcatcgtggccgaactgtcggtg
cgcgagaacatcgtgctcgcgctgcaggcccgcaccggcctcaagcgctgcctgtcggcg
gcccaggaacgcgcgctggccgacaagtacgtgaaggcgctcggcatcaagacggccgac
atcgacacccccatcggcctgctgtccggcggcaaccagcagaaggcgctgctcgcgcgc
tggctggccaccggaccgtcggtgctgatcctcgacgaacccacccgcggcatcgacgtg
gcggccaagcaggagatcatggacgagatcctgcgcctcgcccaggagggcatggcggtg
ctgttcatctcgtccgagatggccgaggtggtgcgggtgtcgcatcgcatcgccgtgctg
cgcgaccgcgccaaggtgggcgaactgcccgccggcagcggcgaacacgccgtgtaccac
ctgatcgccgaagagaccccatga

DBGET integrated database retrieval system