KEGG   Rhizobacter gummiphilus: A4W93_12130Help
Entry
A4W93_12130       CDS       T04831                                 

Definition
(GenBank) phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00770  Pantothenate and CoA biosynthesis
rgu01100  Metabolic pathways
Module
rgu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A4W93_12130
Enzymes [BR:rgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A4W93_12130
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A4W93_12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein SBP_bac_11 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ARN20582
UniProt: A0A1W6L8N2
Position
2735330..2736541
Genome map
AA seq 403 aa AA seqDB search
MTPPLDLQGRRIVLGLTGGIACYKVAEFTRLLVKAGATVNVVMTEGAEQFITPVTMQALS
THPVYTSQWDTREANNMAHINLTRGADAVIVAPASADFIAKLVQGRTDDLLSLLCLARPI
ATCPLLVAPAMNREMWDNPATRRNMAQLREDGATVLGPGNGDQACGEVGDGRMLEPAELL
ADVIAFFAAKRLRGQRVLITAGPTFEPIDPVRGITNLSSGKMGFAIARAAQEAGAEVTLV
AGPVHLPTPRGVRRIDVQTAQQMYDTVLPLAPRHSVFVATAAVADWRPAELSEHKIKKNG
SKVAPTFALTENQDILAAVARLPDRPFCVGFAAESENLLKHAREKLERKNLPLIVGNLGP
ATFGRDDNTLVLVDAQGQRELPPGDKLTLARLLVEDISRRLSA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacccctggatctgcaaggccggcgcatcgtcctcggcctcacgggcggcatc
gcctgctacaaggtcgccgagttcacccgcctgctggtgaaggccggtgccacggtcaac
gtcgtgatgaccgaaggcgccgagcagttcatcaccccggtgacgatgcaggccctgtcc
acgcacccggtctacacgagccagtgggacacgcgagaggccaacaacatggcccacatc
aacctcacgcgcggtgccgacgcggtgatcgtggccccggccagcgccgacttcatcgcc
aagctggtgcagggccgcaccgacgacctgctgagcctgctgtgcctcgcccggcccatc
gccacgtgcccgctgctggtggcgcccgcgatgaaccgcgagatgtgggacaaccccgcc
acgcggcgcaacatggcgcagctgcgcgaggacggcgccacggtgctgggccccggcaac
ggcgaccaggcctgcggcgaggtgggcgacgggcgcatgctcgagcccgccgagctgctc
gccgacgtgatcgcgttcttcgcggccaagcgcctgcgcggccagcgcgtgctcatcacc
gccggccccacgttcgaacccatcgacccggtgcgcggcatcacgaacctctccagcggc
aagatgggcttcgccatcgcccgcgcggcccaggaggccggcgccgaggtcactctggtg
gccgggcccgtgcacctgcccacgccgcgcggcgtgcgccgcatcgacgtgcagacggcg
cagcagatgtacgacaccgtgctgcccctcgcgccgcgccacagcgtgttcgtggccacc
gcggccgtggccgactggcggccggccgagctgtcggaacacaagatcaagaagaacggc
agcaaggtcgcgcccacgttcgcactcaccgagaaccaggacatcctggccgcggtggcg
cgcctgcccgaccgcccgttctgcgtgggtttcgccgccgaaagcgagaacctgctgaaa
cacgcccgcgagaagctcgaacgcaagaacctgcccctcatcgtcggcaacctcggcccg
gccacgttcggccgcgacgacaacaccctggtgctcgtcgacgcccagggccagcgcgaa
ctgccgccgggcgacaagctcacgctcgcgcgcctgctcgtcgaagacatctcccgccgc
ctctccgcctga

DBGET integrated database retrieval system