KEGG   Rhizobacter gummiphilus: A4W93_16605Help
Entry
A4W93_16605       CDS       T04831                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00072  Synthesis and degradation of ketone bodies
rgu00280  Valine, leucine and isoleucine degradation
rgu00650  Butanoate metabolism
rgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A4W93_16605
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A4W93_16605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4W93_16605
Enzymes [BR:rgu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     A4W93_16605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ARN21387
UniProt: A0A1W6LB07
Position
complement(3700991..3701629)
Genome map
AA seq 212 aa AA seqDB search
MAWTHDQMAARAASELQDGFYVNLGIGLPTLVANHVPSDVEVWLQSENGMLGIGPFPTED
EVDADLINAGKQTVTTLPGSSIFGSHDSFAMIRGGKINLSILGAMQVSAKGDLANWMIPG
KMVKGMGGAMDLVAGVGRVLVLMEHVAKKKDGTEDLKIIPACTLPLTGVGVVDRIITDLA
VLDVTPQGLKVVEIAPGVTREELQAKTGVPLI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacccacgaccagatggcggcacgtgccgcgagcgagctgcaggacggcttc
tacgtgaacctgggcatcggcctgcccaccctcgtggccaaccacgtcccttcggacgtc
gaggtgtggctgcagagcgagaacggcatgctgggcatcggcccgttccccacggaagac
gaagtcgatgccgacttgatcaacgccggcaagcagaccgtcaccaccttgcccggctcg
tcgatcttcgggtcgcacgacagcttcgcgatgatccgcggcggcaagatcaacctgagc
atcctcggggccatgcaggtgagcgccaagggcgacctcgccaactggatgatccccggc
aagatggtcaagggcatgggcggcgcgatggacctcgtggccggtgtcggccgcgtgctc
gtgctgatggagcacgtcgcgaagaagaaggacggcaccgaggacctgaagatcatcccg
gcctgcacgctgccgctcacgggcgtgggcgtggtcgaccgcatcatcaccgacctcgcc
gtgctggacgtcaccccgcagggcctgaaggtggtcgagatcgccccgggcgtgacccgc
gaggagctgcaggccaagacgggcgtgccgttgatctga

DBGET integrated database retrieval system