KEGG   Rhizobacter gummiphilus: A4W93_24835Help
Entry
A4W93_24835       CDS       T04831                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00071  Fatty acid degradation
rgu00072  Synthesis and degradation of ketone bodies
rgu00280  Valine, leucine and isoleucine degradation
rgu00310  Lysine degradation
rgu00362  Benzoate degradation
rgu00380  Tryptophan metabolism
rgu00620  Pyruvate metabolism
rgu00630  Glyoxylate and dicarboxylate metabolism
rgu00640  Propanoate metabolism
rgu00650  Butanoate metabolism
rgu00900  Terpenoid backbone biosynthesis
rgu01100  Metabolic pathways
rgu01110  Biosynthesis of secondary metabolites
rgu01120  Microbial metabolism in diverse environments
rgu01130  Biosynthesis of antibiotics
rgu01200  Carbon metabolism
rgu01212  Fatty acid metabolism
rgu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4W93_24835
   00630 Glyoxylate and dicarboxylate metabolism
    A4W93_24835
   00640 Propanoate metabolism
    A4W93_24835
   00650 Butanoate metabolism
    A4W93_24835
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4W93_24835
   00072 Synthesis and degradation of ketone bodies
    A4W93_24835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4W93_24835
   00310 Lysine degradation
    A4W93_24835
   00380 Tryptophan metabolism
    A4W93_24835
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4W93_24835
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4W93_24835
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4W93_24835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rgu04147]
    A4W93_24835
Enzymes [BR:rgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4W93_24835
Exosome [BR:rgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4W93_24835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ARN22875
UniProt: A0A1W6LF37
Position
5453484..5454665
Genome map
AA seq 393 aa AA seqDB search
MSKDIWILSATRTAIGSFGGALKEVPPTQLGATVLREAVKRSGVDPEAFGHVVFGNVIPT
EPRDAYLSRVASMEGGLSKDVPAFNVNRLCGSGLQAIVSAAQAIALGDADFAVGGGAESM
SRGPYMVPAARWGARMGDIAMVDYMTAILHDPFGKFHMGITAENVAAEHGISREMQDELA
LESQRRAVAAIDAGRFKDQIVPVEIAGRKGTVVFDTDEHPRRDASLQALSAMRTVFKKDG
TVTAGNASGINDGAAALVLASAGRARTLGLKPMARLVAYAHAGVDPALMGIGPVPATQRV
LEKAGLKVSDLDVIESNEAFAAQACAVSRALDFDPAKVNVNGSGISLGHPVGATGAIIAT
KALHELQRVQGRYALVTMCIGGGQGIAAIFERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggacatctggatcctcagcgccacccgcaccgccatcggcagcttcggcggc
gcgctcaaggaagtgccgcccacccagctcggcgccaccgtgctgcgcgaagcggtgaag
cgctcgggcgtcgacccggaggccttcggccacgtcgtgttcggcaacgtgatccccacc
gaaccgcgcgacgcgtacctcagccgcgtggcctcgatggagggcggcctgtcgaaggac
gtgcccgcgttcaacgtgaaccgcctgtgcggctcggggctgcaggccatcgtgtcggcc
gcgcaggccatcgcgctcggtgacgccgacttcgccgtgggcggtggcgccgaatcgatg
agccgcggcccgtacatggtgcccgccgcgcgctggggcgcgcgcatgggcgacatcgcg
atggtcgactacatgacggccatcctgcacgacccgttcggcaagttccacatgggcatc
acggccgagaacgtggccgccgaacacggcatctcccgcgagatgcaggacgagctggcg
ctcgagagccagcgccgcgccgtcgccgccatcgacgccggccgcttcaaggaccagatc
gtcccggtggagatcgccggccgcaagggcaccgtggtgttcgacaccgacgaacacccg
cgccgcgacgcctcgttgcaggccctgtcggcgatgcgcaccgtgttcaagaaggacggc
accgtgaccgccggcaacgcgtcgggcatcaacgacggcgccgccgcgctggtgctcgcc
agcgccggccgcgcccgcacgctgggcctgaagccgatggcccgcctggtggcctacgcc
catgccggcgtggacccggcgctgatgggcatcggccccgtgcccgccacgcagcgcgtg
ctggagaaggccggcctcaaggtgagcgacctcgacgtgatcgagtcgaacgaggccttc
gccgcgcaggcctgcgccgtgtcgcgcgcgctcgacttcgacccggccaaggtcaacgtc
aacggctcgggcatctcgctgggccacccggtgggcgccacgggcgccatcatcgccacg
aaggccctgcacgagctgcagcgcgtgcagggccgctacgccctcgtcacgatgtgcatc
ggtggcggccagggcatcgccgcgatcttcgagcgcgcctga

DBGET integrated database retrieval system