KEGG   Rhodococcus jostii: RHA1_ro01315Help
Entry
RHA1_ro01315      CDS       T00382                                 

Gene name
ndkA
Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rha  Rhodococcus jostii
Pathway
rha00230  Purine metabolism
rha00240  Pyrimidine metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
Module
rha_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rha_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
rha_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RHA1_ro01315 (ndkA)
   00240 Pyrimidine metabolism
    RHA1_ro01315 (ndkA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rha04131]
    RHA1_ro01315 (ndkA)
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     RHA1_ro01315 (ndkA)
Membrane trafficking [BR:rha04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    RHA1_ro01315 (ndkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABG93139
UniProt: Q0SH47
Position
complement(1388874..1389293)
Genome map
AA seq 139 aa AA seqDB search
MTERTLVLIKPDAVARGYVGEILGRIERKGLTISALDLRTAPGDIAAAHYAEHEGRPFYP
GLLEFITGGPLVAAVLEGPRAIAAFRQLAGGTDPVEKAVPGTIRGDFGLEAQENLVHGSD
SVESAEREIALWFPHLAAN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagcgcacccttgtactgatcaagcccgatgccgttgcccgcggatatgtagga
gaaatcctcggtcgtatcgagcggaaaggtctgacgatctccgcgctcgacctgcgcacc
gctcccggcgacatcgcagccgcccactacgccgagcacgagggccgccccttctacccc
ggcctgctggaattcatcacgggcggcccgctcgtcgcggcagtcctcgaaggtccccgt
gcgatcgccgcgttccgtcagctcgccgggggcaccgacccggtcgagaaggccgtccca
ggcacgattcgcggcgatttcgggctcgaagcccaggagaacctggtacacggctccgac
tcggtcgagtccgccgagcgcgagatcgccctctggttcccccacctcgccgccaactga

DBGET integrated database retrieval system