KEGG   Rhodococcus jostii: RHA1_ro01340Help
Entry
RHA1_ro01340      CDS       T00382                                 

Gene name
pcaF
Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00072  Synthesis and degradation of ketone bodies
rha00280  Valine, leucine and isoleucine degradation
rha00310  Lysine degradation
rha00362  Benzoate degradation
rha00380  Tryptophan metabolism
rha00620  Pyruvate metabolism
rha00630  Glyoxylate and dicarboxylate metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha00900  Terpenoid backbone biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01212  Fatty acid metabolism
rha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro01340 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    RHA1_ro01340 (pcaF)
   00640 Propanoate metabolism
    RHA1_ro01340 (pcaF)
   00650 Butanoate metabolism
    RHA1_ro01340 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro01340 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    RHA1_ro01340 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro01340 (pcaF)
   00310 Lysine degradation
    RHA1_ro01340 (pcaF)
   00380 Tryptophan metabolism
    RHA1_ro01340 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHA1_ro01340 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro01340 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHA1_ro01340 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rha04147]
    RHA1_ro01340 (pcaF)
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHA1_ro01340 (pcaF)
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHA1_ro01340 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PsbW
Motif
Other DBs
NCBI-ProteinID: ABG93164
UniProt: Q0SH22
Position
1412161..1413387
Genome map
AA seq 408 aa AA seqDB search
MKGLSMRDVVICEPLRTPVGRFGGVFKDINPQSLAATVITALVERTGIEGSQIDDVILGQ
ASPGGEAPAIGRIAALDAGLGIDVPGMQVDRRCGSGLQAVITAVLQVASGGNDLVLAGGA
ESMSQAEFYTNPNIRWGVKGEGVQLADRLARARVTAGGANFPVPGGMIETAENLRAEFDI
SREDQDALAVQSHQRAVAAQDSGRFAEEIVGVTVPQRKSDPLVVDKDEHPRADTTVESLS
KLRAIRSKIDSASTVTAGNASGQNDGAAVCIVTTAEKAKELGLKPLARMASWAVAGVPPR
TMGIGPVPATEKALGQLGLSLSDMGVIELNEAFAAQTLAVLRSWDLDPTDERLNPNGSGI
SLGHPVGATGGRILATLLREMDRRESRYGLETMCIGGGQGLAAVFERV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtctttccatgcgtgacgtcgtcatctgcgagcccctgcgaacgccggtcggg
cgcttcggcggagtgttcaaggacatcaacccgcagagcctcgcggccaccgtcatcacg
gcgctcgtcgaacgcaccggcatcgagggcagccagatcgacgacgtcatcctgggccag
gcgtccccgggcggggaagccccggccatcggccggatcgcggccctcgacgccggactc
ggcatcgacgtccccggcatgcaggtggatcgccgctgcggatccggtctgcaagcggtc
atcaccgccgtgctccaggtggcgtccggcggcaatgatctcgtcctcgccggtggcgcc
gaatccatgagccaggccgagttctacaccaacccgaacatccgctggggcgtcaagggc
gaaggcgtgcaactcgcggaccggctcgcccgcgcccgcgtcaccgccggcggtgcgaac
ttccccgtgccgggcggcatgatcgagaccgccgaaaacctccgcgccgagttcgacatc
agccgtgaggaccaggacgcgctcgccgtgcaatcgcaccagcgtgccgtcgccgcacag
gactcaggacgcttcgccgaggagatcgtcggagtgacggtgccgcaacgcaagtcggac
ccgctcgtcgtcgacaaggacgagcatccgcgcgccgacaccacggtggagtcgctgtcg
aagctccgcgccatccgctccaagatcgactccgcctccaccgtcaccgccggcaacgcc
agcgggcagaacgacggtgccgccgtgtgcatcgtgacaaccgccgagaaggcgaaggaa
ctcgggctgaagcccctcgcccgcatggcgtcctgggccgtggccggcgtcccgccgcgc
accatgggcatcggcccggtgcccgccacggagaaggccctcggtcagctcggactgtcg
ctgtccgacatgggtgtgatcgaactgaacgaggccttcgccgcgcagaccctcgccgtc
ctccgcagctgggacctcgaccccaccgacgaacgcctcaaccccaacggatccggcatc
tccctcggacaccccgtcggcgccaccggcggccgcattctcgccaccctcctgcgggag
atggaccgtcgcgaatcccgctacgggctcgagaccatgtgcatcggcggcggccagggc
ctggctgcggtgttcgagcgggtctga

DBGET integrated database retrieval system