KEGG   Rhodococcus jostii: RHA1_ro01487Help
Entry
RHA1_ro01487      CDS       T00382                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00260  Glycine, serine and threonine metabolism
rha00750  Vitamin B6 metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01230  Biosynthesis of amino acids
Module
rha_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro01487 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHA1_ro01487 (thrC)
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHA1_ro01487 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABG93302
UniProt: Q0SGN4
Position
complement(1568489..1569571)
Genome map
AA seq 360 aa AA seqDB search
MTGTRNPVHTPWPGLIEAYRDRLAIGPNWKTVTLREGGTPLLPAGHLSELTGCDVYLKVE
GLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAAKAKMTCAVLVPQGKI
AMGKLAQAVMHGARIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQKTAAFEI
CDALGKAPDVHALPVGNAGNITAYWRGYSEYYADGLTSVKPRMLGVQAAGAAPLVHGAPV
KDPETIATAIRIGSPASWNGAVTAKEESHGAFRAATDDEILEAYRLIARTEGVFVEPASA
ASVAGLLAARKEGWLDSGLTVVCTVTGNGLKDPDTALAGMPDVQPIPVDPVAVASALELA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacccgtaaccccgttcacaccccctggccggggctgatcgaggcttaccgc
gaccgcctcgccatcggaccgaactggaagacggtcaccctgcgcgagggcggcaccccg
ctgctgcccgccgggcacctgtcggagctcaccggttgcgacgtctacctgaaggtcgag
gggctcaacccgaccggttcgttcaaggaccgcggcatgacgatggccgtcaccgacgcg
ctggcccgcggtcagcaggccgtcctgtgtgcgtccacgggtaacacgtccgcttccgcc
gccgcgtacgccgcgaaggcgaagatgacctgcgccgtgctggtgccgcagggcaagatc
gcgatgggcaagctcgcgcaggccgtcatgcacggcgcgcggatcatccaggtgcagggc
aacttcgacgactgcctcgaactggcccgcaagaccaccgcggagttccccacgatcggg
ctcgtgaactcggtcaacccggtccgcatcgagggccagaagaccgcggcattcgagatc
tgcgacgccctgggcaaggcccccgacgtgcacgcgctcccggtcggcaacgcgggcaac
atcaccgcgtactggcgcgggtactccgagtactacgcggacggactcaccagcgtgaag
ccccgcatgctcggtgtccaggccgccggcgccgcaccgctcgtccacggcgcaccggtg
aaggacccggagacgatcgcgaccgcgatccgcatcggctcgcccgcgtcctggaacggt
gcggtcaccgccaaggaagagtcgcacggcgccttccgggccgcgaccgacgacgagatc
ctcgaggcgtaccggctgatcgccaggaccgaaggggtgttcgtcgaacccgcctcggcc
gcgagcgtcgcgggtctgctcgccgcccgcaaggagggctggctggactcgggcctgacc
gtcgtgtgcacggtcaccggcaacggtctcaaggaccccgacacggcgctggcgggtatg
cctgatgttcaaccgatcccggtcgatcctgtcgctgtcgcgtctgccctcgagctggcg
tag

DBGET integrated database retrieval system