KEGG   Rhodococcus jostii: RHA1_ro01578Help
Entry
RHA1_ro01578      CDS       T00382                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00020  Citrate cycle (TCA cycle)
rha00620  Pyruvate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro01578
   00020 Citrate cycle (TCA cycle)
    RHA1_ro01578
   00620 Pyruvate metabolism
    RHA1_ro01578
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHA1_ro01578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABG93391
UniProt: Q0SGE5
Position
1662265..1663518
Genome map
AA seq 417 aa AA seqDB search
MAQEFRLPDLGEGLTEAELVSWAVEVGQTIELNQVIGEVETAKALVELPSPYAGVVEELL
VPAGATVPVGTPIIRVATNAATEEPPARTPVLVGYGPEAAAESKRARRRLVTAPETGTSG
PDRRRPDASPAARATARELGVDLAVVAGTGPSGAVTRNDVESHAGSAGQSVPSTPEPPEP
SEQSERETRTPIRSVRKQTAAAMVRSAFTAPHVTEFVTVDVTRSVELLERLRGLPDFEGL
SVTPLSLVAKAMIVALRENPSLNASWDEENQEIVTKHYVNLGIAAATPRGLVVPNIKEAQ
SLSLLELCRAITELTATARSGRAEPAQLTGGTVSITNVGVFGVDAGTPILNPGESAILCL
GSVTRRPWVHEDELAVRWVTTLSVSFDHRVVDGEQGSRFLSSVAAMLHDPASLLAHL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcaggaattccgcctacccgatctcggtgaggggctgacggaggccgagctggtc
tcctgggccgtcgaggtgggccagacgatcgaactcaatcaggtgatcggagaagtcgag
acagcgaaggcgctcgtcgagttgccttcgccgtacgcgggtgtcgtagaggaactgctg
gttccggcgggcgcgacggtgccggtcgggacgccgatcatccgggttgcgacgaatgcg
gccaccgaggaacctcccgcgcgcacgcccgttctggtggggtacgggcccgaggccgcc
gccgagagcaaacgggctcggcggaggctggtgaccgctccggagaccggcacgtccggt
ccggaccgtcggcgccccgacgcgtcgccggcggcccgggcgaccgcccgtgaactcggg
gtcgacctcgccgtcgtcgcggggacggggccgtccggcgccgtcacccggaacgacgtc
gaatcccacgcgggttcggccgggcagtccgtgccgtcgacaccggagccgccggaaccg
tcggagcagtcggagcgcgagacccgcacgccgatccgcagcgtccggaagcagaccgcg
gcggcaatggtccgcagcgcgttcaccgccccgcacgtcaccgaattcgtgaccgtcgac
gtgacccggtcggtggaactgctcgaacgactgcgaggcctccccgacttcgagggactg
tcggtgacaccgctgagcctggtcgcgaaggcgatgatcgtcgcgctgcgcgagaacccg
agtctcaacgcctcgtgggacgaggagaaccaggagatcgtcaccaagcactacgtcaat
ctcggtatcgccgcggccacgccccgcggtctggtggtcccgaacatcaaggaggcgcag
tcgctgagcctgctcgaactgtgccgcgcgatcaccgaactgactgctaccgcgcgcagc
ggcagagccgaacccgcgcagctgaccggcggcacggtgtcgatcaccaacgtcggagtg
ttcggtgtcgacgcggggacgccgattctcaaccccggcgaatcggccatcctctgcctg
ggcagcgtcaccaggcgaccgtgggtgcacgaggacgaactcgcggtgcggtgggtcacc
accctgagcgtgtcgttcgatcaccgggtggtcgacggcgagcaggggtcgaggttcctg
tcgtccgtggcggcgatgctgcacgatcccgcctcactgctcgcgcacctctga

DBGET integrated database retrieval system