KEGG   Rhodococcus jostii: RHA1_ro01928Help
Entry
RHA1_ro01928      CDS       T00382                                 

Definition
(GenBank) probable enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00280  Valine, leucine and isoleucine degradation
rha00281  Geraniol degradation
rha00310  Lysine degradation
rha00360  Phenylalanine metabolism
rha00362  Benzoate degradation
rha00380  Tryptophan metabolism
rha00410  beta-Alanine metabolism
rha00627  Aminobenzoate degradation
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha00903  Limonene and pinene degradation
rha00930  Caprolactam degradation
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01212  Fatty acid metabolism
Module
rha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro01928
   00650 Butanoate metabolism
    RHA1_ro01928
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro01928
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro01928
   00310 Lysine degradation
    RHA1_ro01928
   00360 Phenylalanine metabolism
    RHA1_ro01928
   00380 Tryptophan metabolism
    RHA1_ro01928
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro01928
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHA1_ro01928
   00281 Geraniol degradation
    RHA1_ro01928
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro01928
   00627 Aminobenzoate degradation
    RHA1_ro01928
   00930 Caprolactam degradation
    RHA1_ro01928
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHA1_ro01928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG93739
UniProt: Q0SFE7
Position
complement(2043823..2044623)
Genome map
AA seq 266 aa AA seqDB search
MSNGQHMTDVESDRYVRYEVNRGFATLTLDSPHNRNAISGRLVDELLQGLRDAAADNDVR
GVVLTHTGSTFCAGADLSETSGDVGSRTRQMAALLRAIVELPKPVIARIDGHVRAGGMGL
VGACDIAVAGPRSTFALTEVRLGLAASIISLTVLPRIDSRAASRYLLTGEKFGAHEAEAI
GLISESDEDPEDTVQELLDQLRQASPQGLAESKTLTTRSVLADFDRYTDELTAQSARLFE
SEEAREGMMAFLQKRPPRWASGPVRG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacggacagcacatgaccgacgtggaatccgaccggtacgtccggtacgaggtg
aaccgggggttcgccaccctcaccctcgattcgccccacaacaggaacgccatctccggc
aggctcgtggacgaactgctgcagggattgcgggacgccgccgcggacaacgacgtccgc
ggcgtcgtcctcacccacaccggcagcacgttctgcgccggggcggatctgagtgagacg
tccggcgacgtcggctcacgcacccggcagatggccgcactgctacgggcgatcgtcgag
ttgccgaagccggtgatcgcccggatcgacggtcacgtcagggccgggggcatgggattg
gtcggggcctgcgacatcgccgtcgccggcccgcgcagcacgttcgcgctcaccgaggtc
cggctcggactcgccgcgtcgatcatctcgttgaccgtgctgccccgcatcgattcgcgc
gccgcgagccgctacctcctcacgggcgagaagttcggtgcccacgaggcggaggccatc
gggctgatcagcgagtccgacgaggatcccgaggacaccgtccaggaattgctcgaccag
ttgcggcaggcctcgccgcaggggttggccgagtcgaagaccctcacgacccggagcgtg
ctcgccgatttcgaccgctacaccgacgagctgaccgcccagtcggcgaggctgttcgaa
tccgaggaggcgcgggagggcatgatggcgtttctgcagaagcggccgccgagatgggcc
tccggccccgtgcgtggttga

DBGET integrated database retrieval system