KEGG   Rhodococcus jostii: RHA1_ro04461Help
Entry
RHA1_ro04461      CDS       T00382                                 

Definition
(GenBank) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K01770  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
rha  Rhodococcus jostii
Pathway
rha00900  Terpenoid backbone biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01130  Biosynthesis of antibiotics
Module
rha_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHA1_ro04461
Enzymes [BR:rha01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     RHA1_ro04461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YgbB HEAT_2
Motif
Other DBs
NCBI-ProteinID: ABG96247
UniProt: Q0S889
Position
4699071..4699547
Genome map
AA seq 158 aa AA seqDB search
MRVGIGTDVHPIEQGRPCWMAGLLFEDENGCAGHSDGDVAVHALCDALLSAAGLGDLGSV
FGTGRPEWSGVSGAAMLAEVRRLLEEDDFDVANAAVQVIGNRPKIGPRRNEAQKVLSDIL
GAPVSVSATTTDGLGLTGRGEGIAAMATALVIPGRSAR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtcggaatcgggacggacgtccacccgatcgagcaggggcggccgtgctggatg
gccggcctgctgttcgaggacgagaacggctgcgcgggtcactccgacggcgacgtcgcc
gttcacgcactctgcgacgccctgctctccgccgccggactcggcgacctcggctccgtc
ttcggaaccgggcggcccgagtggtccggggtgagcggtgccgcgatgctcgccgaggta
cgccgtctcctcgaagaggacgacttcgacgtcgccaacgccgcggtccaggtgatcggg
aaccggccgaagatcggcccgcgccgaaacgaggcacagaaggtgctgagcgacattctg
ggcgcgccggtttcggtgtccgcgaccaccacggacgggctcggcctcaccgggcgcggc
gaggggatcgccgccatggccaccgcgttggtcattcccggtcgaagcgccaggtag

DBGET integrated database retrieval system